Biological_function,Sf_ID,Entry_ID,Entity_ID
iron ion homeostasis,299,10016,1
iron ion homeostasis,323,10017,1
replication initiation,530,10027,1
Outer-membrane lipoprotein carrier protein,1594,10078,1
Outer-membrane lipoprotein receptor,1971,10096,1
signaling receptor,7407,11006,1
Ras-like protein,7504,11010,1
protein kinase,7505,11010,2
Apical loop of the Trans Activation Response RNA in HIV,7583,11014,1
High affinity RNA aptamer optimized to bind the apical loop of HIV TAR by SELEX.,7584,11014,2
transposase_8,7629,11017,1
Regulatory domain,7671,11018,1
copper chaperone,7689,11019,1
copper chaperone,7725,11020,1
heterokaryon incompatibility,7840,11028,1
prion protein,7840,11028,1
phototaxis,7905,11031,1
transducer protein,7905,11031,1
DNA-binding,7960,11034,1
DNA binding; plant telomere binding,8028,11038,1
copper(I) binding protein,8082,11041,1
proton translocation,8340,11056,1
heterokaryon incompatibility,8489,11064,1
prion protein,8489,11064,1
ubiquitin binding,10139,11149,1
F-actin binding protein,10663,11175,1
carbohydrate-binding activity,15498,11428,1
positive regulator of stomatal density,15784,11452,1
Molecular transportation,16474,11490,1
endonuclease,17431,11545,1
antimicrobial peptide,17548,11551,1
antimicrobial peptide,17566,11552,1
antimicrobial peptide,17584,11553,1
antimicrobial peptide,17602,11554,1
G-actin-binding,17796,11564,1
G-actin-binding,17809,11565,1
G-actin-binding,17823,11566,1
G-actin-binding,17837,11567,1
G-actin-binding,17851,11568,1
Neurotransmitter release,18831,12003,1
Neurotransmitter release,18832,12003,2
Neurotransmitter release,18833,12003,3
Neurotransmitter release,18834,12003,4
Ubiquitin C-terminal hydrolyase,18857,12009,1
Translation Termination Factor,18936,12016,1
binding to insoluble chitin,18965,12019,1
Bind to pSER/pTHR-P ligand,20867,15003,1
malarial invasion,20885,15007,1
phosphotransferase,20901,15008,1
Phosphotransferase,20915,15009,1
Phosphotransferase,20929,15010,1
kinase,21040,15019,1
carotenogenesis,21097,15023,1
DNA binding,21097,15023,1
repressor,21097,15023,1
proton translocation,21113,15025,1
nicotinic receptor antagonist,21207,15031,1
Viral Envelope,21256,15034,1
carotenogenesis,21271,15035,1
DNA binding,21271,15035,1
repressor,21271,15035,1
Unknown,21287,15036,1
Unknown,21302,15037,1
peptidylprolyl isomerase,21316,15038,1
Antimicrobial peptide,21508,15050,1
replication initiation,21585,15055,1
possible ligand binding domain,21687,15060,1
protein splicing,21701,15061,1
thiamine triphosphatase,21723,15063,1
heme degradation,21879,15070,1
Merozoite surface protein,21967,15075,1
hypothetical lipoprotein,22027,15079,1
splicing,22052,15080,1
splicing,22075,15081,1
cytosolic fatty acid binding protein,22097,15082,1
SIGMA-54 BINDING SITE NON-TEMPLATE STRAND,22111,15083,1
SIGMA-54 BINDING SITE TEMPLATE STRAND,22112,15083,2
BINDS -24 PROMOTER ELEMENT,22113,15083,3
TRANSCRIPTION INITIATION,22113,15083,3
bile acids binding,22136,15084,1
peptide binding domain,22201,15087,1
cholesterol inverse transfermation,22293,15091,1
unknown,22439,15100,1
superoxide dismutase,22652,15112,1
antimicrobial,22719,15115,1
protection of viral RNA against host cell defense mechanism,22756,15117,1
phosphotransferase,22905,15126,1
Endoribonuclease involved in T4 mRNA inactivation,22924,15127,1
signalling,22948,15128,1
involved in formation/re-modelling of myelin sheath,23005,15131,1
maintains structural stability of myelin sheath,23005,15131,1
structural protein of the HIV capsid,23111,15137,1
nitrite reductase small subunit,23149,15139,1
unknown,23149,15139,1
Antiviral,23183,15140,1
Antmicrobial,23183,15140,1
possible role in the formation of cutin layers,23231,15143,1
probably involved in the inhibition of bacterial and fungal pathogens,23231,15143,1
the transfer of lipids between membranes,23231,15143,1
tight junction associated protein,23357,15150,1
protein-protein interaction module,23421,15154,1
serine-protease,23421,15154,1
optimal peptide ligand for HtrA1-PDZ,23422,15154,2
erythrocyte binding protein,23493,15158,1
Vibrio Cholerare Primary virulance factor (ADP-ribosyl transferase),23589,15162,1
Copper pump,23627,15164,1
Menkes disease-associated protein,23627,15164,1
unknown,23658,15167,1
protein phosphatase 1 inhibitor,23865,15176,1
transcriptional repressor,23881,15177,1
protein phosphatase 1 inhibitor,23915,15179,1
PP1 binding domain of PP1 targeting protein,23945,15180,1
Ca2+-binding protein,23962,15183,1
Ca2+-binding protein,23963,15183,2
Ca2+-binding protein,23984,15184,1
CaM-binding peptide,23985,15184,2
CaM kinase 1 enzyme,23985,15184,2
Ca2+-binding protein,24004,15185,1
CaM-binding peptide,24005,15185,2
Nitric Oxide Synthase,24005,15185,2
Ca2+-binding protein,24024,15186,1
CaM-binding peptide,24025,15186,2
kinase,24025,15186,2
Ca2+-binding protein,24044,15187,1
Ca2+-binding protein,24064,15188,1
Ca2+ binding protein,24146,15191,1
CaM binding domain of neuronal nitric oxide synthase,24147,15191,2
Methionine-R-sulfoxide reductase,24177,15193,1
Sec95Cys mutant,24177,15193,1
protein-protein interaction domain,24273,15199,1
unknown,24422,15207,1
protease,24687,15222,1
RNA binding,24687,15222,1
resistance to IFN,24741,15225,1
viral replication,24741,15225,1
eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA,24808,15229,1
neureguline receptor,24857,15231,1
protein kinase receptor,24857,15231,1
f-actin binding,25095,15245,1
OMP protein insertion and folding,25123,15247,1
protease,25140,15248,1
ion channel gating,25156,15249,1
protease,25172,15250,1
reductase,25209,15253,1
dimer,25307,15258,1
unknown,25307,15258,1
anticoccidial,25482,15267,1
antimicrobial,25482,15267,1
inhibits lipoproteinlipase (LPL) and LDL receptor binding of lipoproteins,25497,15268,1
cell adhesion,25569,15271,1
Transcriptional regulator and E3 ubiquitin ligase of p53,25629,15274,1
RNA binding,25646,15275,1
signal peptide binding,25646,15275,1
antigen recognition,25666,15276,1
humoral immune response,25666,15276,1
cell proliferation,25920,15289,1
transcription factor,25920,15289,1
ER-Golgi transport,25941,15290,1
intra-Golgi transport,25941,15290,1
vesicle tethering,25941,15290,1
vesicular transport,25941,15290,1
"transcription factor, cell proliferation",26096,15300,1
protein folding,26160,15303,1
apoptosis,26266,15313,1
dimer,26335,15317,1
unknown,26335,15317,1
TRANSCRIPTIONAL REGULATOR (NTRC FAMILY),26652,15334,1
"Putative secretory antigen, amidase",26675,15335,1
RNA Binding Motif,26926,15343,1
unknown,26994,15346,1
thioredoxin-like,27014,15347,1
Innate Immune Response Signaling,27218,15356,1
Toll-Like Receptor Adaptor Protein,27218,15356,1
matrix metallo proteinase,27312,15361,1
Transcriptional regulatory protein,27533,15373,1
DNA binding domain,27649,15378,1
immunoglobulin binding domain,27695,15380,1
muscle contratio regulation,27792,15385,1
transcription regulatory protein,27810,15386,1
muscle contratio regulation,27848,15388,1
muscle contratio regulation,28089,15400,1
calcium binding protein,28162,15404,1
virulence factor,28162,15404,1
Antimicrobial peptide,28340,15413,1
potassium channel inhibitor,28461,15420,1
potassium channel inhibitor,28477,15421,1
inactivation kinetics,28493,15422,1
recovery from inactivation,28493,15422,1
regulatory subunit of Kv4 channels,28493,15422,1
surface expression,28493,15422,1
inactivation kinetics,28541,15425,1
recovery from inactivation,28541,15425,1
regulatory subunit of Kv4 channels,28541,15425,1
surface expression,28541,15425,1
muscle contratio regulation,28575,15427,1
facilitate intracellular lipid transport,28666,15433,1
facilitate lipid uptake and metabolic regulation,28666,15433,1
facilitate intracellular lipid transport,28693,15434,1
facilitate lipid uptake and metabolic regulation,28693,15434,1
Blocks the alpha945;9alpha945;10 nAChR,28724,15435,1
de novo designed protein,28755,15437,1
ENERGY TRANSDUCER,28830,15440,1
Inhibitor of complement syetm,28880,15443,1
DNA binding,28899,15444,1
Collagen binding,28962,15447,1
Adaptor protein that modulates the activity of the ATP-dependent ClpAP bacterial protease,28981,15448,1
Transcription factor,29050,15451,1
unknown,29168,15456,1
membrane protein,29241,15459,1
Antimicrobial peptide,29268,15460,1
Yeast Ccc2 is a P-type ATPase responsible for transport of copper(I) from the cytosol to the trans-Golgi network,29282,15461,1
mutase,29392,15467,1
Calcium signalling,29453,15470,1
Protein kinase activator,29453,15470,1
Neurotransmitter release,29454,15470,2
Vesicle priming,29454,15470,2
Post translational Modification,29504,15473,1
unknown,29555,15476,1
coreceptor in MHCII/TCR interaction,29624,15479,1
cell-mediated immunity,29639,15480,1
neuronal signalling protein,29653,15481,1
RNA binding protein,29729,15485,1
RNA binding protein,29768,15487,1
"kinase, signal transduction pathways",29789,15488,1
unknown,29851,15491,1
Glutamate receptor ligand binding domain,29877,15492,1
Glutamate receptor ligand binding domain,29894,15493,1
Glutamate receptor ligand binding domain,29911,15494,1
Glutamate receptor ligand binding domain,29928,15495,1
Glutamate receptor ligand binding domain,29945,15496,1
Secretin,29962,15497,1
E2 ubiquitin conjugating enzyme,29978,15498,1
NEMO is a regulatory protein of the NF-kappaB signaling pathway,29994,15499,2
NEMO is a regulatory protein of the NF-kappaB signaling pathway,30013,15500,2
Pilot protein,30066,15503,1
Pilot protein,30081,15504,1
Secretin,30082,15504,2
Prolyl cis/trans isomerase,30098,15505,1
translocation of a pore-forming domain,30116,15506,1
PPIase,30130,15507,1
Rotamase,30130,15507,1
binding to the cytoplasmic tail of CD3epsilon,30193,15510,1
T cell activation,30193,15510,1
CD4 downregulation,30250,15513,1
ion channel activity,30250,15513,1
virion budding,30250,15513,1
antibiotic,30280,15515,1
DNA binding homeodomain,30391,15521,1
Homeodomain of the rat thyroid transcription factor 1,30391,15521,1
riboflavin kinase,30557,15530,1
hematopoietic cell growth factor,30577,15531,1
specifically binds the (p50)2 domain of NF-kappa B,30704,15538,1
DUF683,30721,15539,1
unknown,30721,15539,1
co-chaperone,30761,15541,1
scaffold,30762,15541,2
Antimicrobial peptide,30838,15544,1
interferon inducible gene,30852,15545,1
adaptor protein,30965,15551,1
cell adhesion,30979,15552,1
cell migration,30979,15552,1
Lectin,30999,15553,1
endocytosis,31021,15554,1
endocytosis,31022,15554,2
cell apoptosis,31076,15558,1
membrane association segment,31090,15559,1
protein splicing,31106,15560,1
metal binding protein,31123,15561,1
signaling adaptor,31257,15567,1
Uncharacterized Lipoprotein,31276,15568,1
tellutite resistant protein,31428,15574,1
Associated with U2 snRNPs.,31442,15575,1
"Binds splicing factors SNRPB, SNRPC and SF1.",31442,15575,1
remodelling extracellular matrix,31512,15578,1
Antimicrobial peptide,31598,15583,1
NFkB signalling,31720,15591,1
signalling scaffold,31720,15591,1
NFkB signalling,31740,15592,1
signalling scaffold,31740,15592,1
protein histidine phosphatase,31888,15599,1
oxidoreductase,32148,15611,1
glycosyltransferase sugar donor binding subunit,32269,15617,1
calcium binding protein,32389,15624,1
regualte calcium-related pathway,32389,15624,1
serine/threonine protein phosphatase 2B,32390,15624,2
electron transport,32446,15627,1
PPIase,32460,15628,1
siderophore,32485,15629,1
Pantothenate (vitamin B5) synthesis,32718,15643,1
bacterial conjugation,32864,15651,1
Porin with low permeability,32864,15651,1
cytoskeletal protein,32928,15653,1
periplasmic copper detoxification,32966,15655,1
Acyl carrier protein involved in polyketide biosynthesis,33024,15658,1
Involved in polyketide biosynthesis,33040,15659,1
amelogenesis,33111,15662,1
enamel formation,33111,15662,1
Antimicrobial peptide,33209,15667,1
transcription factor,33252,15670,1
transcription factor,33274,15671,1
Piscicolin A126 immunity protein,33313,15673,1
Protein tyrosine phosphatase,33426,15680,1
lipoprotein,33472,15683,1
putative outer membrane protein,33472,15683,1
unknown function,33472,15683,1
Required for efficent assembly and correct sorting of associated protein complex,33535,15685,2
the first soluble N-terminal domain of the P-type ATPase ATP7A,33596,15690,1
Copper(I) metallochaperone,33597,15690,2
Antitoxin,33626,15691,1
Stress response,33626,15691,1
Transcriptional repressor,33626,15691,1
DNA binding domain,33661,15693,1
The earliest activation antigen of human leukocytes,33831,15703,1
GPCR fragment,33929,15708,1
part of C5-epimerase,34059,15716,1
actin binding,34131,15719,1
regulation of smooth muscle contraction,34131,15719,1
electron transfer,34235,15724,1
electron transfer,34275,15725,1
immune evasion,34593,15740,1
histidine biosynthesis,34617,15741,1
lyase,34617,15741,1
antenna protein,34631,15742,1
unknown function,34786,15750,1
Antimicrobial peptide,34814,15751,1
Extracellular matrix component,34881,15756,1
Structural protein,34881,15756,1
bactericidal,34897,15757,1
cytotoxic,34897,15757,1
helminthotoxic,34897,15757,1
Human Ribonuclease,34897,15757,1
Extracellular matrix component,34913,15758,1
Structural protein,34913,15758,1
Extracellular matrix component,34929,15759,1
Structural protein,34929,15759,1
mitochondrial oxidase,35017,15763,1
protein folding,35017,15763,1
ion binding,35041,15764,1
specific inhibitor of Calpain,35080,15766,1
Binding,35124,15769,1
catalysis,35124,15769,1
degradation,35124,15769,1
proteasomal,35124,15769,1
antirepressor,35155,15770,1
unknown,35201,15774,1
Inhibitor of C5a-activated immunoresponse,35287,15778,1
Peptide derived from the extracellular N-terminus of the human C5aR (CD88) receptor,35288,15778,2
virus envelope protein,35389,15782,1
Copper-Responsive Repressor,35599,15793,1
Transcription co-activator,35620,15795,1
unknown,35833,15805,1
hydrolase activity,35853,15806,1
peptidase activity,35853,15806,1
serine endopeptidase activity,35853,15806,1
Major Tail Protein from Bacteriophage Lambda,35873,15807,1
unknown,35949,15810,1
Actin binding protein,36038,15814,1
iron sulfur cluster biosynthesis,36056,15816,1
sulfur oxidation,36056,15816,1
antifreeze protein,36077,15817,1
antifreeze protein,36092,15818,1
Uncharacterized,36108,15819,1
Unknown,36186,15821,1
putative lipoprotein,36307,15825,1
Fluorescent Protein,36354,15826,1
Biomarker,36354,15826,1
Antimicrobial peptide,36377,15827,1
neurohormone receptor,36472,15830,1
neurohormone receptor,36489,15831,1
neurohormone receptor,36505,15832,1
unknown function,36807,15846,1
Putative N-Acetyl Transferase,36865,15848,1
selective conduction of K+ ions across the cell membrane,37022,15853,1
DNA damage,37059,15855,1
growth arrest,37059,15855,1
protein phosphatase 1 inhibitor,37274,15865,1
Adapter protein involved in regulating diverse signal transduction pathways.,37290,15866,1
protein degradation,37291,15866,2
regulation of gene expression,37291,15866,2
ribosome biogenesis and DNA repair,37291,15866,2
stress response,37291,15866,2
DNA binding protein,37391,15871,1
"diadenosine 5',5'''-P1,Pn-oligophosphate hydrolase",37459,15875,1
diphosphoinositol polyphosphate hydrolase,37459,15875,1
"antimicrobial, anticancer, and anti-HIV",37478,15876,1
"chemotaxis, angiogenesis, signal transduciton",37478,15876,1
splicing,37599,15882,1
alternative splicing,37599,15882,1
alternative splicing,37644,15885,1
splicing,37644,15885,1
alternative splicing,37663,15887,1
splicing,37663,15887,1
alternative splicing,37664,15887,2
splicing,37664,15887,2
alternative splicing,37681,15888,1
splicing,37681,15888,1
alternative splicing,37682,15888,2
splicing,37682,15888,2
alternative splicing,37699,15889,1
splicing,37699,15889,1
alternative splicing,37700,15889,2
splicing,37700,15889,2
alternative splicing,37730,15890,1
splicing,37730,15890,1
alternative splicing,37731,15890,2
splicing,37731,15890,2
alternative splicing,37748,15891,1
splicing,37748,15891,1
RNA helicase,37749,15891,2
splicing,37749,15891,2
unknown,37886,15898,1
possible nucleic acid binding protein,37973,15902,1
electron transfer,38055,15904,1
guanine-specific ssRNA cleavage,38091,15905,1
mitochondrial protein,38118,15906,1
protein degradation,38147,15907,1
hydrolase,38221,15909,1
binding domain,38300,15912,1
binding domain,38301,15912,2
actin binding protein,38545,15924,1
structural protein,38545,15924,1
actin binding protein,38565,15925,1
structural protein,38565,15925,1
helicase-loader,38586,15926,1
Cytolysin,38609,15927,1
Hemolysis,38609,15927,1
Ion transport,38609,15927,1
promoter DNA recognition factor,38645,15930,1
cataract,38711,15934,1
folding,38711,15934,1
RNase P proteins,38728,15935,1
RNase P proteins,38729,15935,2
promoter DNA recognition factor,38760,15936,1
Methionine-(R)-Sulfoxide-Reductase,38865,15941,1
p53-binding domain,38950,15945,1
E3 ubiquitin ligase,38982,15948,1
protein tyrosine phosphatase,38998,15949,1
protein transport,39047,15952,1
protein transport,39048,15952,2
Facilitates partner dimerization,39065,15953,1
proton pump,39098,15955,1
heme acquisition protein,39227,15962,1
heme acquisition protein,39252,15963,1
binds tropomodulin,39300,15965,1
forms intermolecular junction with the C terminus of neighboring tropomyosin molecule,39300,15965,1
regulates actin filament dynamics,39300,15965,1
"actin binding site, part of intramolecule junction between tropomyosin molecules",39301,15965,2
Iron-sulfur cluster assembly scaffold protein,39342,15967,1
Co-chaperone protein,39343,15967,2
"Endocytosis, no clathrin disassembly role in budding yeast.",39359,15968,1
Viral capsid core protein,39375,15969,1
protein binding,39435,15973,1
disulfide bond formation; disulfide bond isomerisation; ligand binding,39452,15974,1
promoter DNA recognition factor,39468,15975,1
Antimicrobial peptide,39507,15978,1
Antimicrobial peptide,39521,15979,1
Antimicrobial peptide,39535,15980,1
cell adhesion,39584,15986,1
collagen binding,39584,15986,1
development,39584,15986,1
matrix protein,39584,15986,1
motogenic activity,39584,15986,1
structural protein,39584,15986,1
cell migration,39585,15986,2
collagen cleavage,39585,15986,2
development,39585,15986,2
matrix protein,39585,15986,2
structural protein,39585,15986,2
Energy Transduction,39624,15988,1
disulfide bond formation,39803,15998,1
disulfide bond isomerisation,39803,15998,1
ligand binding,39803,15998,1
DNA binding,39819,15999,1
transcriptional regulator,39819,15999,1
Transcription regulator,39887,16001,1
intein,40025,16009,1
protein splicing domain,40025,16009,1
Ribotoxin,40147,16018,1
Proton channel,40188,16020,1
Cytolytic peptide,40339,16028,1
Outer membrane protein biogenesis,40492,16035,1
channel,40645,16045,1
nucleic acid binding protein,40744,16051,1
SPP1 head-to-tail connector protein,40860,16057,1
DNA Ligase,40898,16059,1
Snake poison,40915,16060,1
Nicotinic Acetylcholine Receptor,40916,16060,2
water borne pheromone,40961,16062,1
Toxin,41029,16065,1
Transcriptional cofactor,41029,16065,1
translation inhibitor,41029,16065,1
Antitoxin,41030,16065,2
Transcriptional repressor,41030,16065,2
Toxin,41056,16066,1
Transcriptional cofactor,41056,16066,1
translation inhibitor,41056,16066,1
Antitoxin,41079,16067,1
Transcriptional repressor,41079,16067,1
pilus type IV biogenesis,41115,16069,1
unknown,41154,16071,1
unknown,41226,16075,1
unknown,41240,16076,1
unknown,41254,16077,1
unknown,41268,16078,1
unknown,41282,16079,1
unknown,41296,16080,1
Acyl Carrier Protein,41372,16085,1
antifungal,41386,16087,1
cytochrome c biogenesis,41530,16096,1
heme chaperone protein,41530,16096,1
DNA INTEGRATION,41698,16102,1
APOPTOSIS,41729,16103,1
Allergen,41880,16111,1
Cajal body protein,41952,16115,1
Inhibits the adhesion of alpha-1/beta-1-K562 (ITGA1/ITGB1) cells to collagen IV.,42272,16136,1
SH3 domain,42328,16139,1
Insecticidal neurotoxin,42345,16140,1
putative organic hydroperoxide resistance protein,42415,16144,1
Part of two-peptide bacteriocin,42487,16148,1
Part of two-peptide bacteriocin,42506,16149,1
"Inhibits the adhesion of alpha-1/beta-1-K562 (ITGA1/ITGB1) cells to collagen IV.
Does not show inhibitory activity toward other integrins, including
alpha-IIb/beta-3 (ITGA2B/ITGB3), alpha-v/beta-3 (ITGAV/ITGB3), alpha-2/beta-1
(ITGA2/ITGB1), alpha-5/beta-1 (ITGA5/ITGB1), alpha-4/beta-1 (ITGA4/ITGB1),
alpha-6/beta-1 (ITGA6/ITGB1), and alpha-9/beta-1 (ITGA9/ITGB1).",42525,16150,1
"Inhibits the adhesion of alpha-1/beta-1-K562 (ITGA1/ITGB1) cells to collagen IV.
Does not show inhibitory activity toward other integrins, including
alpha-IIb/beta-3 (ITGA2B/ITGB3), alpha-v/beta-3 (ITGAV/ITGB3), alpha-2/beta-1
(ITGA2/ITGB1), alpha-5/beta-1 (ITGA5/ITGB1), alpha-4/beta-1 (ITGA4/ITGB1),
alpha-6/beta-1 (ITGA6/ITGB1), and alpha-9/beta-1 (ITGA9/ITGB1).",42542,16151,1
Inhibits the adhesion of alpha-1/beta-1-K562 (ITGA1/ITGB1) cells to collagen IV.,42559,16152,1
transcription repressor,42576,16153,1
nucleic acid binding protein,42601,16154,1
cell adhesion,42694,16158,1
cell migration,42694,16158,1
cell adhesion,42711,16159,1
cell migration,42711,16159,1
Regulatory (targeting) subunit of protein phosphatase 1 in the myosin phosphatase holoenzyme.,42744,16160,1
cell adhesion,42788,16162,1
cell migration,42788,16162,1
involved in HCV replication,42857,16165,1
involved in HCV particles production and assembly,42872,16166,1
"regulatory subunit of the Na,K-ATPase in kidney",42887,16167,1
"regulatory subunit of the Na,K-ATPase",42903,16168,1
ribonuclease,42921,16169,1
ribonuclease,42935,16170,1
ribonuclease,42949,16171,1
ribonuclease,42963,16172,1
FUNCTION UNKNOWN,42997,16174,1
FUNCTION UNKNOWN,42998,16174,2
splicing factor,43035,16176,1
leader sequence of the prepropeptide of patellamide biosynthesis,43152,16182,1
"The protein encoded by this gene is a member of the immunophilin protein family, 
which play a role in immunoregulation and basic cellular processes involving 
protein folding and trafficking. This encoded protein is a cis-trans prolyl 
isomerase that binds the immunosuppressants FK506 and rapamycin, as well as 
histone deacetylases, the transcription factor YY1, casein kinase II, MDM2, and 
nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be 
an important target molecule for immunosuppression by rapamycin. The C-terminal 
domain is primarily responsible for rapamycin binding has a beta fold similar to 
other FKBP proteins (Liang et al., 1996, 1pbk), while the N-terminal domain 
deposited here has an all-alpha structure. The sequence of the N-terminal domain 
shows low homologies to other sequences, in accordance with this, a DALI 
comparison shows only distant fold similarities. Although basically a helix 
bundle, only helices 2, 3 and 5 are folding towards each other in a classical, 
antiparallel manner. The construct used to determine this structure contains 
residues 1-73; constructs extended c-terminally did not add further structured 
entities to the fold. The determination of the structure of the FKBP3 N-terminal 
domain will be helpful in understanding the molecular relationships between 
FKBP3 and its many interacting proteins.",43318,16189,1
regulation of alternative splicing,43377,16192,2
regulation of polyadenylation,43377,16192,2
regulation of alternative splicing,43395,16193,2
regulation of polyadenylation,43395,16193,2
regulation of alternative splicing,43415,16194,2
regulation of polyadenylation,43415,16194,2
biosynthesis,43468,16197,1
Polyketide carrier protein,43468,16197,1
Acyl Carrier Protein from the Actinorhodin Polyketide Pathway,43500,16199,1
Acyl Carrier Protein from the Actinorhodin polyketide pathway of Streptomyces coelicolor,43562,16201,1
chaperone,43761,16213,1
unknown,44176,16238,1
"Anti-microbial peptide, part of two-peptide bacteriocin plantaricin JK together with PlnK",44258,16241,1
scaffold for Iron-sulfur cluster assembly,44313,16245,1
Dimerization of fiber chains,44382,16249,1
regulation of fiber assembly,44382,16249,1
Potent neurite growth inhibitor in vitro and plays a role both in the restriction of axonal regeneration after injury and in structural plasticity in the CNS.,44557,16257,1
Antimicrobial protein,44631,16261,1
Detoxification of hydroperoxides,44704,16265,1
"Histone mRNA binding and processing.  Protein is required for processing, export, and translation of replication-dependent histone mRNAs",44905,16274,1
the Actuator or A domain of copper transporting ATPase has a regulatory function and is required for the phosphatase step of the catalytic cycle (dephosphorylation of the intermediate formed during ATP hydrolysis).,44965,16277,1
"Molecular chaperone that promotes the maturation, structural maintenance and 
proper regulation of specific target proteins involved in cell cycle control and 
signal transduction. Undergoes a functional cycle that is linked to its ATPase 
activity. The nucleotide-free form of the dimer is found in an open conformation 
in which the N-termini are not dimerized and the complex is ready for client 
protein binding. Binding of ATP induces large conformational changes, resulting 
in the formation of a ring-like closed structure in which the N-terminal domains 
associate intramolecularly with the middle domain and also dimerize with each 
other, stimulating their intrinsic ATPase activity and acting as a clamp on the 
substrate. Finally, ATP hydrolysis results in the release of the substrate. This 
cycle probably induces conformational changes in the client proteins, thereby 
causing their activation. Interacts dynamically with various co-chaperones that 
modulate its substrate recognition, ATPase cycle and chaperone function. 
Required for growth at high temperatures.",45012,16279,1
regulation of cellular growth,45102,16284,1
ser/thr kinase,45102,16284,1
nucleic acid binding,45255,16293,1
protein interactions,45255,16293,1
RNA polymerase II CTD interaction,45255,16293,1
splicing factor,45255,16293,1
Transcription factor,45255,16293,1
possible role in the formation of cutin layers,45272,16294,1
probably involved in the inhibition of bacterial and fungal pathogens,45272,16294,1
the transfer of lipids between membranes,45272,16294,1
regulation of cellular growth,45290,16295,1
ser/thr kinase,45290,16295,1
Antibody fragment from Camel,45457,16305,1
bile acids binding and transport,45540,16309,1
Associated with glucose metabolism,45642,16314,1
Putative prophage CPS-53 integrase,45660,16315,1
phage integrase-like protein,45681,16316,1
antimicrobial pepitde,45747,16319,1
E2 ubiquitin conjugating enzyme,45793,16321,1
Inducer of matrix metalloproteinases,45809,16322,1
RNA binding protein,45830,16323,1
Thiol:disulfide oxidoreductase,45897,16329,1
Thiol:disulfide oxidoreductase,45926,16330,1
antibiotic activity,45955,16333,1
dna transfection,45955,16333,1
"NCS-1 interact with many proteins, some in calcium dependent and some in calcium independent ways like calcineurin,  GRK2 (G-protein-coupled receptor kinase 2), D2 Dopamine receptor, IL1RAPL (interleukin-1 receptor accessory protein-like protein ARF1 (ADP Ribosylation factor, Nitric oxide synthase etc.",45969,16334,1
NCS-1 plays an important role in the modulation of neurotransmitter release and phosphatidylinositol signaling pathway.,45969,16334,1
Antibiotic resistance by phosphorylation of aminoglycoside antibiotics,46024,16337,1
chaperonin,46041,16338,1
CoB,46041,16338,1
Tubulin-binding,46041,16338,1
ubiquitin-like,46041,16338,1
SUGAR BINDING PROTEIN,46068,16339,1
transcelullar calcium transport,46101,16340,1
A ribosomal protein involved in protein translation.,46174,16344,1
"Localizes to dynamic actin structures, and phosphorylates CRK and CRKL, DOK1, and other proteins controlling cytoskeleton dynamics.",46269,16349,1
"Regulates cytoskeleton remodeling during cell differentiation, cell division and cell adhesion.",46269,16349,1
Mating pheromone,46306,16350,1
calcium binding protein,46489,16360,1
calcium binding protein,46490,16360,2
cytolysin,46537,16362,1
Hemolysis,46537,16362,1
ion transport,46537,16362,1
translation machinery-associated protein 16,46598,16365,1
Protein phosphatase 2A homologue,46619,16366,1
putative hydrolase / phosphatase,46619,16366,1
chloride channel,46640,16367,1
DNA binding,46658,16368,1
HTH arsR,46658,16368,1
transcriptional regulator,46658,16368,1
wHTH,46658,16368,1
winged helix,46658,16368,1
Secreted,47098,16386,1
"Mediates electron transfer from NADH to oxygen, reducing it to water. This 
modular protein has 3 redox cofactors, in other organisms the same activity 
requires 2 or 3 proteins (By similarity)",47157,16388,1
Hydrolase,47258,16392,1
chloride channel,47286,16393,1
chloride channel,47303,16394,1
HISTONE DEUBIQUITINATION,47353,16397,1
HISTONE DEUBIQUITINATION,47460,16402,1
Glutaredoxin,47478,16403,1
copper-binding protein,47568,16408,1
copper resistance,47568,16408,1
mutase reaction interconverting beta-glucose 1-phosphate and beta-glucose 6-phosphate,47590,16409,1
tryptase inhibitor,48031,16435,1
tryptase inhibitor,48050,16436,1
tryptase inhibitor,48069,16437,1
tryptase inhibitor,48088,16438,1
two domains of the alternative complement pathway regulator Factor H,48107,16439,1
nucleotide binding,48128,16440,1
nucleotide binding,48151,16441,1
calcium binding,48632,16465,1
calmodulin binding domain,48633,16465,2
ASIC1a blocker,48686,16468,1
guanine-specific ssRNA cleavage,48711,16469,1
phosphatase,48748,16470,1
adaptor protein,48749,16470,2
cytoskeletal regulator,48764,16471,1
multidomain scaffold protein,48764,16471,1
Rubredoxin,48800,16473,1
UDP-3-O-acyl N-acetylglucosamine deacetylase,48822,16475,1
"hydrolysis of beta-1,3 linked glucose polymers (laminarin)",48960,16481,1
proteasomal degradation,49042,16484,1
"transcription factor, endogenous modulator of pRb/E2F cell cycle target genes",49058,16485,1
RRM1 gene encodes for Ribonucleotide Reductase M1 subunit essential for S-phase DNA synthesis,49059,16485,2
Growth Factor,49230,16493,1
Growth Factor,49249,16494,1
cell adhesion,49279,16496,1
cell adhesion,49280,16496,2
unknown,49318,16498,1
Growth Factor,49421,16502,1
ribonuclease,49438,16503,1
Biosynthesis of fatty acids in P. falciparum,49491,16506,1
DNA repair; transcriptional regulation,49663,16516,1
Arsenate reductase,49678,16517,1
uncharacterized protein,49765,16521,1
pore formation,49816,16523,1
toxin,49816,16523,1
Biosynthesis of fatty acids in P. falciparum,49932,16529,1
Biosynthesis of fatty acids in P. falciparum,49962,16530,1
Biosynthesis of fatty acids in P. falciparum,49979,16531,1
Biosynthesis of fatty acids in P. falciparum,49996,16532,1
Biosynthesis of fatty acids in P. falciparum,50013,16533,1
Transcriptional Regulator,50078,16538,1
Translational Regulator,50078,16538,1
Tumour Suppressor,50078,16538,1
Transcriptional Regulator,50164,16542,1
Translational Regulator,50164,16542,1
Tumour Suppressor,50164,16542,1
"Small GTPase, Arf6 guanine nucleotide exchanger factor (GEF)",50318,16550,1
"Guanine nucleotide exchange factore (GEF) for small molecule GTPase,Arf6",50332,16551,1
unknown,50366,16556,1
Zn-binding,50366,16556,1
unknown,50494,16560,1
unknown,50693,16568,1
unknown function,50757,16570,1
DNA binding protein,50781,16571,1
electron transfer,50948,16579,1
guanine-specific ssRNA cleavage,50994,16580,1
mitochondrial protein,51035,16581,1
protein degradation,51056,16582,1
"endo-1,4-beta-D-xylan-hydrolysis",51099,16583,1
hydrolase,51132,16584,1
Llama heavy chain antibody selected against PABPN1,51175,16586,1
Activator of Hsp90 ATPase,51212,16588,1
Hydrolysis of the beta-lactam ring of beta-lactama antibiotics.,51403,16598,1
membrane signal peptide,51474,16601,1
regulator of voltage-gated potassium channel KCNQ1,51492,16602,1
Scaffolding Fe-S cluster assembly and enhancing Fe-S cluster transfer to the target apo-protein,51507,16603,1
synthetic neomycin sensing riboswitch,51531,16604,1
artifical riboswitch: able to regulate gene expression upon ligand binding,51633,16609,1
"Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction.",51692,16611,1
"Proposed to mediate activation of the JNK pathway and apoptosis via MAP3K5 in response to signaling from TNFRSF6 and TGFBR2. Interaction with HSPB1/HSP27 may prevent interaction with TNFRSF6 and MAP3K5 and block DAXX-mediated apoptosis. In contrast, in lymphoid cells JNC activation and TNFRSF6-mediated apoptosis may not involve DAXX. Seems to regulate transcription in PML/POD/ND10 nuclear bodies together with PML and may influence TNFRSF6-dependent apoptosis thereby. Down-regulates basal and activated transcription. Seems to act as a transcriptional co-repressor and inhibits PAX3 and ETS1 through direct protein-protein interaction. Modulates PAX5 activity. Its transcription repressor activity is modulated by recruiting it to subnuclear compartments like the nucleolus or PML/POD/ND10 nuclear bodies through interactions with MCSR1 and PML, respectively.",51693,16611,2
proton channel,51715,16612,1
cytokine,51761,16614,1
haematopoietic growth factor,51761,16614,1
DNA-binding protein,51778,16615,1
regulator of voltage-gated potassium channel KCNQ1,51899,16621,1
signal transduction,51914,16622,1
E2 conjugating enzyme interaction domain,51929,16623,1
E3 ubiquitin ligase,51929,16623,1
ion channel gating,52000,16628,1
cytolysin,52047,16630,1
Hemolysis,52047,16630,1
RNA packaging,52331,16646,1
putative enterotoxin,52350,16647,1
:wpossible N-acetylmuramoyl-L-alanine amidase activity,52350,16647,1
YabP family,52575,16656,1
Cyclin-dependent kinase inhibitor,52613,16657,1
regulation of cell-cycle progression,52613,16657,1
Cyclin-dependent kinase inhibitor,52614,16657,2
regulation of cell-cycle progression,52614,16657,2
Cyclin-dependent kinase inhibitor,52615,16657,3
regulation of cell-cycle progression,52615,16657,3
Cyclin-dependent kinase inhibitor,52616,16657,4
regulation of cell-cycle progression,52616,16657,4
Cyclin-dependent kinase inhibitor,52617,16657,5
regulation of cell-cycle progression,52617,16657,5
Cyclin-dependent kinase inhibitor,52618,16657,6
regulation of cell-cycle progression,52618,16657,6
Cyclin-dependent kinase inhibitor,52619,16657,7
Stress Response,56807,16876,1
regulation of cell-cycle progression,52619,16657,7
Transmembrane segment of receptor tyrosine kinase EGFR,52649,16658,1
Transmembrane segment of receptor tyrosine kinase ErbB2,52650,16658,2
Cyclin-dependent kinase inhibitor,52677,16659,1
is targeted to ubiquitin ligase SCF(Cdc4) upon phosphorylation,52677,16659,1
regulation of cell-cycle progression,52677,16659,1
Cyclin-dependent kinase inhibitor,52678,16659,2
is targeted to ubiquitin ligase SCF(Cdc4) upon phosphorylation,52678,16659,2
regulation of cell-cycle progression,52678,16659,2
Cyclin-dependent kinase inhibitor,52679,16659,3
is targeted to ubiquitin ligase SCF(Cdc4) upon phosphorylation,52679,16659,3
regulation of cell-cycle progression,52679,16659,3
Cyclin-dependent kinase inhibitor,52680,16659,4
is targeted to ubiquitin ligase SCF(Cdc4) upon phosphorylation,52680,16659,4
regulation of cell-cycle progression,52680,16659,4
Cyclin-dependent kinase inhibitor,52681,16659,5
is targeted to ubiquitin ligase SCF(Cdc4) upon phosphorylation,52681,16659,5
regulation of cell-cycle progression,52681,16659,5
Cyclin-dependent kinase inhibitor,52682,16659,6
is targeted to ubiquitin ligase SCF(Cdc4) upon phosphorylation,52682,16659,6
regulation of cell-cycle progression,52682,16659,6
Cyclin-dependent kinase inhibitor,52683,16659,7
is targeted to ubiquitin ligase SCF(Cdc4) upon phosphorylation,52683,16659,7
regulation of cell-cycle progression,52683,16659,7
neuromodulator,52727,16660,1
Substance P is a Neuromodulator,52728,16660,2
Fatty Acid Biosynthesis,52744,16661,1
"lysozyme hydrolyzes the 1,4 linkages between N-acetylmuramic acid and N- acetylglucosamine",52803,16664,1
antimicrobial peptide,52847,16666,1
insecticidal neurotoxin,52862,16667,1
GTPase,52877,16668,1
GTPase,52897,16669,1
class A beta-lactamase,52969,16673,1
serine protease inhibitor,53027,16676,1
neisseria meningitidis antigen,53082,16679,1
cell shape-determining protein,53211,16685,1
branched amino acid biosynthesis,53257,16687,1
"Isoleucine, leucine, valine biosynthesis, pantothenate biosynthesis.",53257,16687,1
SH3 family,53275,16688,1
catalyzes the extracytoplasmic formation of disulphide bonds in newly synthesized proteins,53332,16689,1
thiol-disulphide oxidoreductase,53332,16689,1
prolyl isomerase,53364,16690,1
membrane fusion peptide,53563,16699,1
membrane fusion peptide,53592,16700,1
the catalytic domain of Oligosaccharyl Transferase.,53609,16701,1
protease inhibitor,53624,16703,1
serine protease inhibitor,53642,16704,1
serine protease inhibitor,53660,16705,1
Lipid II binding,53693,16707,1
Lipid II binding,53730,16709,1
Essential for initiation of X-Chromosome Inactivation in female mammals,53814,16714,1
Epigenetics,53962,16721,1
gene expression regulation,53962,16721,1
"NCS-1 interact with many proteins, some in calcium dependent and some in calcium independent ways like calcineurin,  GRK2 (G-protein-coupled receptor kinase 2), D2 Dopamine receptor, IL1RAPL (interleukin-1 receptor accessory protein-like protein ARF1 (ADP Ribosylation factor, Nitric oxide synthase etc.",54016,16726,1
NCS-1 plays an important role in the modulation of neurotransmitter release and phosphatidylinositol signaling pathway.,54016,16726,1
antimicrobial,54030,16727,1
Anthrax lethal toxin endopeptidase component,54139,16735,1
Zinc Metallopeptidase,54139,16735,1
ADP-ribosyltransferase,54173,16737,1
antimicrobial peptide,54218,16739,1
Electron transfer,54245,16740,1
Electron transfer,54262,16741,1
antifungal,54343,16745,1
antimicrobial,54343,16745,1
chitin-binding,54343,16745,1
Adhesin,54402,16748,1
"assembles to a needle-like structure of the TTSS. 
Essential for bacterial infectivity.",54801,16770,1
"Lmo2 is a member of the LIM-only protein family, the sequences of which consist of little more than two tandemly arrayed LIM domains. LIM domains are a class of zinc 
finger that ligate two zinc ions and which bind proteins rather than DNA (Bach 2000). Lmo2 plays a critical role in blood cell development (hematopoiesis).",54946,16779,1
microtubule transport,54983,16781,1
molecular motor,54983,16781,1
Photosystem II reaction center Psb28 protein,54997,16782,1
membrane transporter,55049,16783,1
unknown,55177,16790,1
involved in HCV particles production and assembly,55367,16798,1
involved in HCV particles production and assembly,55382,16799,1
involved in HCV particles production and assembly,55397,16800,1
unknown function,55412,16801,1
CDK2 regulatory protein,55573,16808,1
binding domain,55606,16809,1
binding domain,55607,16809,2
translationally-controlled tumor protein,55959,16833,1
viral protease,56047,16837,1
Tissue factor initiates the blood coagulation cascade upon forming a complex with factor VIIa,56062,16838,1
pheromone binding,56100,16840,1
Gelatin/collagen binding,56119,16841,1
Antimicrobial against Pseudomonas aeruginosa,56183,16845,1
Interraction with charged membrane,56183,16845,1
Transglutaminase substrate,56183,16845,1
coreceptor in MHCII/TCR interaction,56345,16853,1
putative acyl carrier protein,56472,16860,1
putative lipopolysaccharide synthesis,56472,16860,1
Histidine kinase inhibitor,56572,16863,1
DNA Repair Enzyme,56687,16869,1
Tubulin folding,56705,16870,1
Chaperone,56807,16876,1
"domain of protein-protein interaction, scaffolding",56877,16879,1
polyketide aromatase/cyclase,56920,16881,1
phospholipase A1/2,56957,16883,1
tumor suppressor,56957,16883,1
Alternate Splicing involved in myotonic dystrophy,56975,16884,1
domain of RNA binding protein,56975,16884,1
membrane protein,57017,16886,1
binds to the beta chain of haemoglobin to form the functional haemoglobin that performs oxygen transport in human blood,57106,16891,1
alpha haemoglobin is bound by AHSP to inhibit redox cycling and precipitation,57217,16898,1
Response Regulator,57354,16905,1
Membrane fusion,57370,16907,1
P. falciparum erythrocyte cytoadherence protein,57468,16911,1
activator for MinD ATPase,57671,16921,1
regulator of bacterial cell division,57671,16921,1
immunophilin,57722,16925,1
prolyl cis-trans isomerase,57722,16925,1
Regulation hERG channel function,57780,16928,1
prolyl cis-trans isomerase; immunophilin,57846,16931,1
prolyl cis-trans isomerase; immunophilin,57893,16933,1
Thrombin is the main protease of the blood coagulation system,58034,16940,1
"located at 5' end of HIV-1 RNA, promotes transcription activation by binding viral protein Tat",58056,16941,1
unknown function,58119,16943,1
Regulatory domain of type II protein kinase-A (PKA(RIIa).  Recognizes and regulates the binding to different members of the A-kinase anchoring protein (AKAP) family for phosphorylation of targets.,58324,16954,1
"Nervy homology region 3 acts as an A-kinase anchoring protein (AKAP), and recruits type II protein kinase-A (PKA(RIIa)).",58325,16954,2
YabP family,58474,16961,1
oxidoreductase,58513,16962,1
thioredoxin like,58513,16962,1
Insecticidal toxin,58552,16963,1
heterokaryon incompatibility,58568,16964,1
prion protein,58568,16964,1
heterokaryon incompatibility,58583,16965,1
prion protein,58583,16965,1
acyl carrier protein domain,58597,16966,1
"part of TraI, a protein involved in cutting, unwinding, and then re-ligating specific plasmid DNA in bacterial conjugation.",58714,16971,1
sweet protein,58751,16978,1
putative PTS system enzyme IIB component,58778,16979,1
unknown function,59231,17002,1
Peptide Methionine Sulfoxide reductase,59325,17008,1
Regulation of L-Tryptophan expression,59384,17010,1
Loss of repression at/above 42 degree Celsius temperature,59422,17012,1
Regulation of L-Tryptophan expression,59422,17012,1
Extraordinarily high repression,59443,17013,1
Regulation of L-Tryptophan expression,59443,17013,1
"Mediates protein-protein interactions with Rassf1C, p53 and Mdm2",59545,17018,1
"Protein protein interactions with Rassf1C, p53 and Mdm2",59566,17019,1
Recognition motif for the DAXX helical bundle (DHB) domain,59567,17019,2
"unknown function, protein family(DUF88).",59595,17020,1
Proteasomal shuttling protein,59689,17023,1
Linked to muscle Atrophy,59710,17024,1
Proteasomal shuttling protein,59710,17024,1
Is covalently attatched  to other proteins at lysine residsues. Signal for degradation and key signalling molecule in multiple processes,59711,17024,2
modulation of the activity of nicotinic acetylcholine receptor,59804,17027,1
Dictyostelium discodium Formin-C: role for fruiting body formation/ cell movement during multicellular stages of the slime mold,59834,17029,1
Formins general: nucleation/formation of actin filaments,59834,17029,1
light energy harvesting antennae of photosystem II in cyanobacteria,59895,17031,1
phycobilisome linker protein,59895,17031,1
sweet protein,59928,17032,1
unknown,59973,17034,1
Hypothetical protein,59998,17035,1
putative proto-chlorophyllide reductase 57 kD subunit superfamily,59998,17035,1
DUF2500 superfamily,60058,17038,1
predicted inner membrane protein,60058,17038,1
unknown function,60058,17038,1
CARDB superfamily cell surface protein,60090,17039,1
cell adhesion related domain,60090,17039,1
COG1572,60090,17039,1
PFAM 07705,60090,17039,1
Regulation of intracellular L-Trp concentrations by repressing the trp operon,60156,17041,1
Interacts with DLC1,60181,17042,1
membrane segment,60195,17043,1
Temperature sensitive regulation of intracellular L-Trp concentrations by repressing the trp operon,60245,17046,1
Regulation of intracellular L-Trp concentrations by repressing the trp operon even at minimal concentrations,60271,17047,1
transcriptional repression,60325,17050,1
photoreceptor for chromatic adaptation,60560,17064,1
Mitochondrial Import and Assembly protein,60612,17067,1
Oxidative Protein Folding,60612,17067,1
Copper Chaperone of CcO,60613,17067,2
Inhibitor/regulator of Fe-S cluster formation,60632,17068,1
Iron chaperon,60632,17068,1
signal transduction,61077,17089,1
gene control at transcriptional level,61427,17106,1
Phorbol ester and diacylglycerol (DAG) binding domain,61537,17112,1
phorbol ester and diacylglycerol (DAG) binding domain.,61556,17113,1
"b-D-glucosidase implicated in angiogenesis and metastatic process. This enzyme is able to degrade one of the components of extracelullar matrix, the heparan sulphate",61788,17126,1
Domain 11 of IGF2R in complex with IGF-II,61807,17127,1
Free IGF-II is regulated by IGF2R,61808,17127,2
IGF-II act via the tyrosine kinase type 1 IGF receptor (IGF-1R) to promote cell survival and proliferation,61808,17127,2
Fragment of the Cation-independent mannose-6-phosphate receptor that binds IGF-II,61832,17128,1
Mutated residues in the AB loop region to improve binding affinity,61832,17128,1
variable region of a 72 base-pair MUC1 DNA aptamer obtained by SELEX,61852,17129,1
Structural protein,61907,17131,1
"UBA domain of OTUD7A, deubiquitinating enzyme",61923,17132,1
IGF-II binding domain of the Cation-independent mannose-6-phosphate receptor from Opossum,61966,17134,1
"Promotes the biosynthesis of heme as well as the assembly and repair of
iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways.
It also plays a primary role in the protection against oxidative stress through
its ability to catalyze the oxidation of Fe2+ to Fe3+ and to store large amounts
of the metal in the form of a ferrihydrite mineral",61987,17135,1
"double-stranded RNA binding, protein binding, miRNA binding;",62075,17141,1
miRNA processing,62092,17143,1
RNA binding,62092,17143,1
electron transport,62109,17144,1
electron transport,62147,17146,1
Implicated in the control of cell growth.,62216,17149,1
Plays a role in the regulation of intracellular calcium levels.,62216,17149,1
"Required in brain development and mature brain function with important roles in the regulation of axon growth, axon guidance, and neurite extension.",62216,17149,1
Role in CNTN1-mediated signaling.,62216,17149,1
antimicrobial peptide,62291,17152,1
mRNA 3'-end-processing,62476,17161,1
mRNA 3'-end-processing,62477,17161,2
photochromic fluorescent protein,62503,17162,1
photochromic fluorescent protein,62519,17163,1
transcription factor,62628,17170,1
found in conjugate transposon,62767,17176,1
RNase P protein subunit,63061,17190,1
RNase P protein subunit,63062,17190,2
putative Uracil DNA glycosylase,63078,17191,1
ubiquitin binding,63190,17195,1
DNA Repair Enzyme,63287,17201,1
actin binding,63366,17206,1
molecular chaperon,63426,17208,1
molecular chaperon,63452,17209,1
molecular chaperon,63472,17210,1
ubiquitin binding,64000,17238,1
ubiquitin binding,64023,17239,1
oxidoreductase,64093,17242,1
Domain of the major pilin RrgB of Streptococcus pneumoniae,64171,17246,1
Component of the Type IV Secretion System; Protein transport,64362,17257,1
Cysteine Protease Inhibitor,64388,17258,1
ubiquitin C-terminal hydrolases,64420,17260,1
transcriptional regulation; DNA damage repair; Cell-cycle control,64536,17265,1
metal chaperon,64561,17266,1
metal efflux,64561,17266,1
Iron-sulfur cluster scaffolding fucntion,64895,17282,1
Ribonuclease and Phosphatase,64921,17283,1
mRNA interferase,65013,17288,1
neuronal cell adhesion,65064,17290,1
protein-protein interaction,65064,17290,1
designed peptide with GPCR subtype specificity,65079,17291,1
DNA Binding Protein,65257,17301,1
fatty acid carrier,65274,17302,1
fatty acid carrier,65294,17303,1
inflammation,65341,17305,1
innate immunity,65341,17305,1
pre-mRNA 3' end processing,65407,17308,1
Hsp90 Co-factor,65500,17312,1
Pih1 Co-factor,65500,17312,1
pre-mRNA 3' end processing,65524,17313,1
unknown function,65594,17318,1
DUF971,65613,17319,1
unknown function,65613,17319,1
transcription factor,65732,17325,1
Binds myosin VI at actin cones in Drosophila spermatogenesis,66155,17353,1
Spermatogenesis in Drosophila,66173,17354,1
RNA-binding,66809,17386,1
RNA-binding,66827,17387,1
Binds tryptophan ligand and only then is activated to bind trp-RNA,67141,17400,1
"E3 ubiquitin ligase, co-chaperone",67357,17411,1
Binds tryptophan ligand and only then is activated to bind trp-RNA,67399,17413,1
serine threonine kinase,67470,17417,1
pro-angiogenic,67644,17426,1
involved in phycobilisome,67690,17429,1
ubiquitin conjugating enzyme (E2),67861,17437,1
middle portion of anchor protein Akap79,68027,17445,1
Sap97 binding partner,68027,17445,1
scaffolding protein,68042,17446,1
pheromone binding,68057,17447,1
unknown function,68077,17448,1
playing roles in myelin formation and maintenance,68211,17454,1
playing roles in Schwann cell development and proliferation,68211,17454,1
cell growth suppressor,68241,17456,1
viral RNA replication; signal transduction; virus persistence,68454,17468,1
mitogen-activated protein kinase,68500,17471,1
Study on ICL3 of 5HT1A receptor and its molecular interaction with calmoudlin,68776,17487,1
bacterial c-di-GMP receptor,68953,17496,1
single-domain PilZ protein,68953,17496,1
nitrogen-dependent repression of the ureidosuccinate utilization pathway,69013,17499,1
Hydrolase,69139,17505,1
RNA polymerase II C-terminal domain phosphatase,69249,17510,1
bacterial DnaG primase,69288,17512,1
Proteolytic cleavage of a norovirus genome encoded poplyprotein into 6 mature nonstructural proteins,69470,17523,1
nitrogen-dependent repression of the ureidosuccinate utilization pathway,70389,17570,1
Maintain solubility and stability over many years in the eye lens. Structural protein.,70505,17576,1
Maintain solubility and stability over many years in the eye lens. Structural protein.,70623,17582,1
RNA endonuclease,70853,17595,1
ribosome assembly factor,70853,17595,1
fungal surface coating protein,70879,17596,1
putative glyoxylase,70901,17597,1
Ribosomal stalk protein involved in binding of elongation factors during the course of protein synthesis.,71308,17616,1
F-actin crosslinking protein,71487,17626,1
Cytoskeletal protein required for organization of normal actin cytoskeleton; scaffolding protein,71488,17626,2
"scaffolding protein, involved in multiple binding interactions associated with actin cytoskeleton and muscle sarcomere",71506,17627,1
dsRNA-binding,71573,17630,1
dsRNA binding,71589,17631,1
biological photosensor,71740,17640,1
Inhibitor/regulator of Fe-S cluster formation,71759,17641,1
Iron chaperon,71759,17641,1
Blue-light receptor,71788,17643,1
ATPase,72107,17660,1
mRNA export,72180,17664,1
multifunctional,72180,17664,1
unknown,72321,17672,1
Ligand-gated ion Channel (LGIC),72716,17695,1
Membrane and transport protein,72716,17695,1
F-Actin Binding Protein,72758,17698,1
peptidyl-prolyl cis-trans isomerase,73088,17713,1
protein protein binding domain,73129,17715,1
Useful for studying protein folding,73193,17718,1
Sodium-Calcium Exchanger,73256,17721,1
Sodium-Calcium Exchanger,73270,17722,1
Formation of viral capsid,73623,17738,1
Regulatory domain of Hck,73673,17740,1
Insulin-like growth factor inhibitor,73727,17743,1
Ser/Thr kinase,73820,17748,1
transcription corepressor activity,73950,17753,1
"Activator of Hsp90 ATPase homolog 1-like 
protein",74940,17809,1
proton pump,75139,17817,1
Regulatory domain of Hck,75177,17819,1
Binding of hemoglobin,75194,17820,1
Extraction of heme from hemoglobin,75194,17820,1
carbohydrate binding,75307,17826,1
pro-apoptotic effector,75307,17826,1
thiol-disulfide oxidoreductase,75401,17830,1
thiol-disulfide oxidoreductase,75418,17831,1
selecting gene for a DETC gamma delta T cell subset,75451,17833,1
Iron-sulfur cluster scaffolding protein,75505,17836,1
Iron-sulfur cluster scaffolding protein,75522,17837,1
Iron-sulfur cluster scaffolding protein,75653,17844,1
Cysteine desulfurase,75654,17844,2
electron transfer,75670,17845,1
electron transfer,75691,17846,1
electron transfer,75712,17847,1
electron transfer,75733,17848,1
mutase reaction interconverting beta-glucose 1-phosphate and beta-glucose 6-phosphate,75813,17851,1
mutase reaction interconverting beta-glucose 1-phosphate and beta-glucose 6-phosphate,75834,17852,1
RNA binding protein,76356,17878,1
Carrier of the growing fatty acid chain in fatty acid biosynthesis,76513,17886,1
Participates in Eukaryotic splicing,76809,17901,1
Specifically binds to the anticodon 'UUU' of lysyl-tRNA,76892,17905,1
regulator,77258,17926,1
Glutaminase activity,77434,17935,1
A microtubule binding domain of dynactin,77471,17937,1
Microtubule associated protein (MAP),77614,17945,1
neuronal Tau protein,77614,17945,1
Paired Helical Filaments (PHF) formation,77614,17945,1
"5,6,7,8-tetrahydrofolate : NADP+ oxidoreductase",77631,17946,1
reductase,77631,17946,1
Region of the Ser/Thr kinase Bubr1 responsible for localisation to the kinetochore,77852,17960,1
Region of Blinkin protein which binds Bubr1 N domain,77853,17960,2
pre-mRNA splicing,77872,17961,1
antitumor protein,78189,17973,1
cytotoxic protein,78189,17973,1
hydrolase-ribonuclease,78189,17973,1
Fungal coat protein,78282,17978,1
Reduce surface tension,78282,17978,1
Modulates CaM activity,78347,17981,2
Modulates CaM activity,78384,17983,2
anticancer,78419,17986,1
antimalaria,78419,17986,1
antimicrobial,78419,17986,1
Malaria cytoadherence protein,78659,17999,1
Tb24 is a calcium sensor in T. brucei.,78952,18011,1
Responsible for the binding of collagen,79137,18020,1
Responsible for the binding of collagen,79153,18021,1
N-end rule recognition element,79216,18025,1
N-terminal recognition,79216,18025,1
guanylyl cyclase regulation,79231,18026,1
Electron Transport,79283,18029,1
Sulfhydryl Oxidase containing FAD,79283,18029,1
presumed ribosomal assembly factor,79314,18031,1
putative involvement in oxidative stress,79314,18031,1
lipid A synthesis,79335,18032,1
specialized acyl carrier protein,79335,18032,1
modular interaction domain,79762,18054,1
modular interaction domain,79776,18055,1
modular interaction domain,79791,18056,1
modular interaction domain,79806,18057,1
modular interaction domain,79821,18058,1
modular interaction domain,79836,18059,1
modular interaction domain,79851,18060,1
modular interaction domain,79866,18061,1
modular interaction domain,79881,18062,1
modular interaction domain,79896,18063,1
modular interaction domain,79911,18064,1
modular interaction domain,79926,18065,1
modular interaction domain,79941,18066,1
modular interaction domain,79956,18067,1
modular interaction domain,79971,18068,1
modular interaction domain,79986,18069,1
modular interaction domain,80001,18070,1
modular interaction domain,80016,18071,1
modular interaction domain,80031,18072,1
modular interaction domain,80046,18073,1
modular interaction domain,80061,18074,1
modular interaction domain,80076,18075,1
modular interaction domain,80091,18076,1
modular interaction domain,80106,18077,1
modular interaction domain,80121,18078,1
signal transduction,80651,18103,1
regions of MARCKS phosphorylated isoform specific for neuroblasts and some types of neurons,80675,18104,1
regions of MARCKS phosphorylated isoform specific for neuroblasts and some types of neurons,80695,18105,1
regions of MARCKS phosphorylated isoform specific for neuroblasts and some types of neurons,80717,18106,1
Forms beta barell in the outer membranes and transports passenger domain out of the cell.,80755,18108,1
RNA polymerase interacting domain of CdnL,80996,18121,1
neuronal membrane receptor,81512,18155,1
ATP-dependent integral membrane protease,81530,18156,1
paraplegin-like,81530,18156,1
To suppress host defense,81574,18157,1
Part of the Deubiquitination complex of SAGA transcription factor,82248,18192,1
Interaction with RNA polymerase beta subunit,82278,18193,1
Interacts with the RNA polymerase beta subunit but not CarG.,82301,18194,1
"The RNA polymerase interacting domain of Myxococcus xanthus global transcriptional regulator CarD involved in light-induced carotenogenesis, fruiting-body development and other processes.",82301,18194,1
Regulatory/targeting subunit of nuclear PP1,82373,18198,1
Heme Transport Protein HasR,82449,18201,1
Transmembrane signaling,82449,18201,1
N-alpha acetyltransferase,82464,18202,1
N-epsilon acetyltransferase,82464,18202,1
Raf-1 Kinase Inhibitory Protein,82501,18204,1
Unkown,83185,18235,1
cysteine protease,83200,18236,1
Chaperone,83559,18257,1
"structural protein, part of the cytoskeleton",83598,18260,1
AcpXL,83654,18263,1
lipid A synthesis,83654,18263,1
specialized acyl carrier protein,83654,18263,1
Binding partner of the Wiskott-Aldrich Syndrome protein (WASp),83694,18265,1
Receptor for Hepatitis C virus E2 protein,83849,18280,1
"normal function unknown, forms amyloid known to enhance HIV infection",83965,18287,1
cysteine protease inhibitor,84496,18317,1
RNA binding,84636,18324,1
bacterial cell division,84930,18339,1
halotolerant beta lactamase,85579,18373,1
cytochrome c maturation,85703,18380,1
heme chaperone,85703,18380,1
Zinc-sensing transcriptional regulator,86254,18413,1
Zinc-sensing transcriptional regulator,86270,18414,1
regulation of actin cytoskeleton dynamics in neurons; co-suppressor of the potent transcription regulator WT1,86326,18417,1
secretion channel,86554,18428,1
type IV pilus secretin,86554,18428,1
specialized acyl carrier protein,87301,18468,1
Archeal Oligosacchryltransferase,87461,18477,1
oxydo reduction enzyme,87595,18486,1
oxydoreduction enzyme,87648,18488,1
Unknown,87780,18494,1
Ras GTPase; involved in cell cycle regulation.,88468,18529,1
extracellular component of membrane attack complex of complement,88487,18530,1
GPVI mimetic,88620,18537,1
calicheamicin synthesis,88826,18547,1
Membrane localization to anionic phospholipids. Is believed to target effector domains (C2 and C3 domains) to inner cell leaflet.,89223,18565,1
not fully characterized,89238,18566,1
"Full-length VASP enhances actin polymerization to modulate filament formation and cytoskeletal rearrangement, in response to extracellular signals.",89289,18569,1
"The EVH1 domain of VASP recruits the protein to binding partners (zyxin, vinculin) via specific recognition of FPPPP motifs.",89289,18569,1
Triacylglyceride hydrolysis; lipase; esterase,89410,18574,1
"Triacylglyceride hydrolase, lipase, esterase",89427,18575,1
"Griffithsin is a lectin that binds carbohydrate, in particular mannose.  It could bind high mannose structure on HIV gp120, thus interfere HIV  entry.",89621,18585,1
"Isoleucine, leucine, valine biosynthesis, pantothenate biosynthesis.",89741,18591,1
branched amino acid biosynthesis,89741,18591,1
DNA-binding,89844,18598,1
Response regulator,89844,18598,1
Periplasmic Binding Proteins bind sugars and act in the signalling cascade of the chemotactic response,90014,18603,1
First receptor in the chemotactic response,90140,18609,1
Sugar binding causes closure of the two domains of the protein,90140,18609,1
DNA binding,90239,18615,1
isomerase,90239,18615,1
microtubule assembly,90239,18615,1
Histone mRNA metabolic process,90343,18620,1
RNA- binding,90343,18620,1
tRNA modification,90343,18620,1
Histone mRNA metabolic process,90359,18621,1
RNA- binding,90359,18621,1
tRNA modification,90359,18621,1
Peptidyl-Prolyl Isomerase,90489,18628,1
Protein Chaperone,90489,18628,1
pathogenesis,90962,18651,1
protein transport,90962,18651,1
"protease, ATPase, DNA binding protein",90976,18652,1
May regulate the surface expression of some potassum channels by retaining them in the endoplasmic reticulum,91413,18676,1
protease,91413,18676,1
co-chaperone,91638,18689,1
RNA-binding protein,91800,18698,1
sialic acid binding lectin,91962,18704,1
cell adhesion,92255,18718,1
cell migration,92255,18718,1
cell adhesion,92270,18719,1
cell migration,92270,18719,1
Members of the fibroblast growth factor receptor family (FGFR1 to 4) are key mediators of both developmental and disease-associated angiogenesis.,92707,18741,1
Signalling,92734,18748,1
Inhibitor of transcription factor NFkappaB,92857,18756,1
Inhibitor of transcription factor NFkappaB,92923,18759,1
Somatostatin Mimic,116209,20043,1
Inhibitor of transcription factor NFkappaB,92952,18760,1
nucleic acid binding,93044,18765,1
DNA damage response,93076,18767,1
orotate phosphoribosyltransferase,93216,18774,1
orotate phosphoribosyltransferase,93237,18775,1
Bacterial Tyrosine KInase,93539,18791,1
OXIDOREDUCTASE,93663,18798,1
OXIDOREDUCTASE,93680,18799,1
OXIDOREDUCTASE,93711,18800,1
centriole assembly,93849,18807,1
structural protein,93849,18807,1
Acyl group carriers in bacterial fatty acid biosynthesis.,94071,18819,1
acyl group carriers in bacterial fatty acid biosynthesis,94101,18820,1
acyl group carriers in bacterial fatty acid biosynthesis.,94118,18821,1
major pilin of type IV pilus,94152,18823,1
binding to prodomains of bone morphogenetic proteins,94612,18843,1
fibrillin microfibril formation,94612,18843,1
Alternative splicing factor,94655,18845,1
Alternative splicing factor,94676,18846,1
"LewisX is a blood group antigen, other names are CD15 (cluster of differentiation 15) and SSEA-1 (stage specific embryonic antigen)",95314,18873,1
Chromatin remodelling,95336,18874,1
Gene regulation,95336,18874,1
Tumor suppression,95336,18874,1
proteasome assembly; proteasome substrate unfolding,95567,18885,1
The CD3 complex mediates signal transduction.,95663,18890,1
transcriptional complex,95847,18898,1
Antimicrobial pepide,96193,18915,1
electron transport,96270,18919,1
Lymphocyte adhesion,96658,18941,1
Dimerization,96777,18947,1
gain in endonuclease activity,97157,18969,1
phosphorelay,97881,19006,1
muscle protein,97959,19010,1
muscle protein,97979,19011,1
Motor protein associated with microtubules,98157,19025,1
Role in formation of knob during erythrocyte invasion by the plasmodium,98219,19029,1
Motor protein associated with microtubules,98249,19031,1
Microtubule plus-end tracking protein,98250,19031,2
protein tyrosine phosphatase,98556,19046,1
hemoglobin binding,98768,19056,1
translation regulation,98883,19063,1
translation regulation,98899,19064,1
viral protease of DENV2,99194,19080,1
NS2B cofactor region of NS2B-NS3pro complex,99195,19080,2
SUMO1/sentrin specific peptidase 1,99254,19083,1
RNA binding,99468,19098,1
Peptide vaccine,99717,19112,1
Regulation of eukaryotic translation initiation,99755,19114,1
"lysozyme hydrolyzes the 1,4 linkages between N-acetylmuramic acid and N- acetylglucosamine",99984,19127,1
neuropeptide,100179,19140,1
neuropeptide,100196,19141,1
acid-stress bacterial chaperone,100653,19165,1
gene repression,100771,19171,1
recruiting binding partners for heterochromatin formation,100771,19171,1
Removal of adenylate intermediates from DNA,100972,19182,1
Fyn-SH3 ligand,101041,19186,1
eIF4E-binding protein,101148,19191,1
Component of the 20S proteasome,101203,19194,1
large protease complex with broad specificity involved in protein degradation,101203,19194,1
Component of the 20S proteasome,101204,19194,2
large protease complex with broad specificity involved in protein degradation,101204,19194,2
proteasome-activating protein,101205,19194,3
RNA binding protein,101383,19203,1
"Immunophilin,Ryanodine binding",102110,19240,1
"Immunophilin,Ryanodine binding",102128,19241,1
Functions as an amino acid passive transporter across the outer chloroplast membrane,102593,19267,1
Viral oncoprotein,102635,19269,1
retinoic acid binding and transport,102668,19271,1
Protein tyrosine phosphatase,102685,19272,1
"Ferredoxin are iron-sulfur proteins that transfer electrons in a wide variety of
metabolic reactions. Although the function of this ferredoxin is unknown it is
probable that it has a role as a cellular electron transfer protein. Involved in
the in vivo assembly of the Fe-S clusters in a wide variety of iron-sulfur
proteins.",102705,19273,1
"Probable pathogen-recognition receptor involved in peripheral immune surveillance in liver. May mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens, including HIV-1 gp120, HIV-2 gp120, SIV gp120, ebolavirus glycoproteins, HCV E2, and human SARS coronavirus protein S. Is a receptor for ICAM3, probably by binding to mannose-like carbohydrates. Is presumably a coreceptor for the SARS coronavirus.",103144,19297,1
Oxidoreductase,103241,19301,1
Endonuclease activity and acting as bifunctional nucleases,103359,19307,1
Endonuclease and bifunctional nucleases,103376,19308,1
Centriolar component,103528,19318,1
RNA binding,103569,19320,1
"Immunophilin,Ryanodine binding",103620,19323,1
"Immunophilin,Ryanodine binding",103638,19324,1
Lysine-specific demethylase,103704,19328,1
ubiquitination-promoting E3 complex protein,103737,19329,1
adhesion protein,103928,19339,1
Dephosphorylation of host macrophage protein VPS33B to block phagosome-lysosome fusion and trafficking,104215,19361,1
Essential for infection of host macrophages,104215,19361,1
Calcium binding,104380,19369,1
Calcium binding,104398,19370,1
Calcium binding,104416,19371,1
"Cytokine, immune system",104516,19377,1
"Block of voltage gated sodium channels Nav1.4 (SCN4A) 
mu-PIIIA-1 IC50 =46.7+/-6.5 nM",104627,19384,1
"Block of voltage gated sodium channels Nav1.4 (SCN4A)   
mu-PIIIA-2 IC50 =103.2+/-9.9 nM",104648,19385,1
Dephosphorylation of host macrophage protein VPS33B to block phagosome-lysosome fusion and trafficking,104712,19388,1
Essential for infection of host macrophages,104712,19388,1
determining the rate of inactivation of the channel,105420,19426,1
calcium-dependent cell-cell adhesion,105723,19443,1
"trans-membrane, and extracellular (EC) protein",105723,19443,1
Protein Phosphatase 1 nuclear-targeting subunit 10,105856,19451,1
unknown,106090,19461,1
unknown,106110,19462,1
unknown,106130,19463,1
TNRC6B is a gene regulator involved in gene silencing via Argonaute interactions,106368,19478,1
a Novel Compact Myelin Protein,106502,19485,1
Homo sapiens small VCP/p97-interacting protein,106502,19485,1
galactoside-binding lectin,106612,19491,1
"Important in: cell adhesion, cell activation and chemoattraction, cell growth and differentiation, cell cycle, and apoptosis",106612,19491,1
Termination of protein synthesis on eukaryotic ribosome,106884,19506,1
regulation of muscle contraction,107106,19518,1
muscle contraction,107107,19518,2
"maintaining genomic integrity, DNA helicase",107316,19530,1
Crc is one of the global regulators in Pseudomonads. It is proposed to regulate genes by binding target RNA and prevent the formation of a translation initiation complex,107887,19558,1
molecular chaperone,107929,19560,1
molecular chaperone,107930,19560,2
Sorting Ubiquitinated proteins to Lysosomes,108120,19569,1
GTPase activating protein,108448,19589,1
ubiquitin binding in autophagy,108773,19606,1
Alternative splicing factor,110036,19680,1
Alternative splicing factor,110172,19686,1
Structural protein,110770,19719,1
Molecular chaperone,110983,19730,1
Molecular chaperone,111039,19733,1
Virus that infect bacteria,111055,19734,1
Virus that infect bacteria,111056,19734,2
"The methylarginines ADMA and MMA inhibit the production of nitric oxide
synthase.DDAH is important in removing methylarginines, generated by protein
degradation, from accumulating and inhibiting the generation of nitric oxide 
in mammals.",111216,19742,1
"In mammals, the enzyme dimethylarginine dimethylaminohydrolase (DDAH) is
implicated in the regulation of the cellular levels of asymmetric
methylarginines, small molecule metabolites that themselves represent a family
of endogenous inhibitors of nitric oxide synthase (NOS). The involvement of DDAH
function in the regulation of NOS makes this enzyme a potentially attractive
therapeutic target.",111245,19744,1
Non-lytic virus that infect bacteria,111300,19747,1
cytoskeletal adaptar protein,111434,19753,1
Secreted Wnt inhibitor protein,111646,19768,1
"The RodA hydrophobin of the opportunistic pathogen Aspergillus fumigatus forms
an amyloid monolayer with a rodlet morphology that covers the surface of fungal
spores. 
This rodlet layer bestows hydrophobicity to the spores facilitating their dispersal in the air.",111868,19782,1
Hsp90 binding protein,111928,19787,1
Hsp90 binding protein,111947,19788,1
Anthrax lethal toxin endopeptidase component,112129,19803,1
Interaction with Protective Antigen(PA),112129,19803,1
Cytosolic domain of mPanx1 channel involved in regulation of the channel opening and closure,112288,19814,1
Carbohydrate-binding module,112558,19831,1
Peroxide reduction,113558,19884,1
SUMO1/sentrin specific peptidase 1,113574,19885,1
Regulation of eukaryotic translation initiation,113802,19905,1
apoptosis,114115,19927,1
"binding pocket for NAD+ metabolites: ADP-ribose, PAR, and negatively charged molecules such as RNA",114115,19927,1
chromatin repair,114115,19927,1
Outer membrane protein assembly factor,114134,19928,1
"Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response. Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens, including HIV-1 gp120, HIV-2 gp120, SIV gp120, ebolavirus glycoproteins, cytomegalovirus gB, HCV E2, dengue virus gE, Leishmania pifanoi LPG, Lewis-x antigen in Helicobacter pylori LPS, mannose in Klebsiella pneumonae LPS, di-mannose and tri-mannose in Mycobacterium tuberculosis ManLAM and Lewis-x antigen in Schistosoma mansoni SEA.",114187,19931,1
RNA processing,114814,19967,1
interaction with the 5 - untrasnlated region (UTR) of some cellular mRNAs,114814,19967,1
recognition of the 5 -ppp end of nascent RNA,114814,19967,1
"Ribosome Biogenesis, centrosome duplication and tumor suppression",115084,19982,1
toxin,115232,19990,1
Endogenous opioid neurotransmitter/neuromodulator,115443,20003,1
Endogenous opioid neurotransmitter/neuromodulator,115461,20004,1
Endogenous opioid neurotransmitter/neuromodulator,115479,20005,1
antimicrobial peptide,115602,20012,1
antimicrobial peptide,115680,20016,1
antimicrobial peptide,115698,20017,1
antimicrobial peptide,115716,20018,1
sodium channel inhibitor,115837,20024,1
sodium channel inhibitor,115855,20025,1
Cardiovascular,115936,20029,1
Fluid Balance,115936,20029,1
Cardiovascular,115973,20030,1
Fluid Balance,115973,20030,1
Cardiovascular,115997,20031,1
Fluid Balance,115997,20031,1
autoinducer,116021,20032,1
pheromone,116021,20032,1
quormone,116021,20032,1
Somatostatin Mimic,116087,20036,1
Somatostatin Mimic,116103,20037,1
Somatostatin Mimic,116120,20038,1
Somatostatin Mimic,116137,20039,1
Somatostatin Mimic,116154,20040,1
Somatostatin Mimic,116173,20041,1
Somatostatin Mimic,116191,20042,1
Antimicrobial peptide,116504,20057,1
Antimicrobial peptide,116520,20058,1
Antimicrobial peptide,116536,20059,1
Antimicrobial peptide,116565,20060,1
Antimicrobial peptide,116581,20061,1
antimicrobial action,116852,20078,1
glucagon receptor antagonist,117271,20105,1
Primes poliovirus RNA polymerase,117341,20110,1
antimicrobial peptide,117398,20113,1
Neuromodulator,117438,20115,1
neuromodulator,117454,20116,1
neuromodulator,117471,20117,1
Inhibiting tubulin polymerization,117534,20121,1
cardioactive,117551,20122,1
antimicrobial peptide,117604,20125,1
Agonist of the nociceptin receptor,117640,20127,1
"core 1,3-fucosylation of N-glycans in invertebrates and plants",118509,21032,1
Serine Protease Inhibitor,118792,21056,1
"DE NOVO PROTEIN (ARTIFICIALLY DESIGNED, OFTEN SYNTHETIC)",118875,21064,1
"DE NOVO PROTEIN (ARTIFICIALLY DESIGNED, OFTEN SYNTHETIC)",118893,21065,1
"DE NOVO PROTEIN (ARTIFICIALLY DESIGNED, OFTEN SYNTHETIC)",118911,21066,1
"DE NOVO PROTEIN (ARTIFICIALLY DESIGNED, OFTEN SYNTHETIC)",118929,21067,1
"DE NOVO PROTEIN (ARTIFICIALLY DESIGNED, OFTEN SYNTHETIC)",118947,21068,1
"DE NOVO PROTEIN (ARTIFICIALLY DESIGNED, OFTEN SYNTHETIC)",118965,21069,1
"DE NOVO PROTEIN (ARTIFICIALLY DESIGNED, OFTEN SYNTHETIC)",118983,21070,1
"DE NOVO PROTEIN (ARTIFICIALLY DESIGNED, OFTEN SYNTHETIC)",119002,21071,1
"DE NOVO PROTEIN (ARTIFICIALLY DESIGNED, OFTEN SYNTHETIC)",119021,21072,1
"DE NOVO PROTEIN (ARTIFICIALLY DESIGNED, OFTEN SYNTHETIC)",119040,21073,1
viral entry,119166,21079,1
IN VIVO AND IN VITRO INHIBITOR OF POLYGLUTAMINE AGGREGATION AND TOXICITY,121664,25022,1
Cardiac muscle contraction,121874,25034,1
Cardiac muscle contraction,121901,25035,1
"Probable pathogen-recognition receptor involved in peripheral immune
surveillance in liver. May mediate the endocytosis of pathogens which are
subsequently degraded in lysosomal compartments. Probably recognizes in a
calcium-dependent manner high mannose N-linked oligosaccharides in a variety of
pathogen antigens, including HIV-1 gp120, HIV-2 gp120, SIV gp120, ebolavirus
glycoproteins, HCV E2, and human SARS coronavirus protein S. Is a receptor for
ICAM3, probably by binding to mannose-like carbohydrates. Is presumably a
coreceptor for the SARS coronavirus.",122109,25046,1
beta-lactam hydrolysis,122319,25063,1
splicing and dosage compensation,122515,25072,1
dosage compensation in Drosophila,122566,25078,1
beta-lactam hydrolysis,122599,25080,1
The regulation of PfPP1 phosphatase activity in Plasmodium falciparum,122983,25108,1
"binding pocket for NAD+ metabolites: ADP-ribose, PAR and negatively charged molecules such as RNA",123373,25132,1
viral replication,123373,25132,1
Transport Factor,124276,25182,1
Transport Factor,124293,25183,1
Transport Factor,124310,25184,1
Transport Factor,124327,25185,1
designed halophilic sequence from unique domine of SRC Kinase,124538,25196,1
aciniform spider silk,124556,25197,1
RNA-binding,125282,25239,1
tRNA modification,125282,25239,1
Protein involved in gene expressrion post-transcriptional regulation.,125374,25244,1
E3 Ubiquitin Ligase,125406,25248,1
protein polyubiquitination,125406,25248,1
transforming growth factor beta receptor signaling pathway,125406,25248,1
E3 Ubiquitin Ligase,125426,25249,1
protein polyubiquitination,125426,25249,1
transforming growth factor beta receptor signaling pathway,125426,25249,1
Participates in the assembly of the 60S pre-ribosome,125608,25264,1
Molecular chaperone,125742,25271,1
Prolyl peptidyl isomerase,125742,25271,1
OXYGEN TRANSPORT,125985,25285,1
OXYGEN TRANSPORT,126004,25286,1
"Peptide component in the venom of vermivorus marine cone snail, Conus monile",126332,25302,1
Recombinantly expressed and purified peptide Mo3964 modulates voltage gated ion channels present on rat DRG neurons.,126332,25302,1
Peptidyl Prolyl Isomerase,127050,25341,1
GLIDING MOTILITY of Mycoplasma genitalium,127147,25346,1
E3 Ubiquitin Ligase,127254,25351,1
Transforming growth factor beta receptor signaling pathway,127254,25351,1
protein polyubiquitination,127254,25351,1
Binding of neurotensin peptide,127505,25367,1
Translocation factor for bacterial protein sysnthesis,127520,25368,1
Protein Tyrosine Phosphatase,127612,25375,1
substrate binding domain of Ssa1 (Hsp70),127786,25385,1
"Required for Pcad induction, a promoter upstream of cadBA that is responsible for the pH-regulated expression of CadA and CadB. Probably acts as an activating transcription factor.",128306,25417,1
"TGFBIp has been found to be a major protein in the human cornea. Mutations
occurring in TGFBIp may cause the eye dystrophies, which lead to blindness. The
majority of the diseases causing mutations are located in the last domain of
TGFBIp, named fourth fascilin-1 (FAS1-4) domain.",128475,25425,1
Protein Phosphatase 1 binding domain,128570,25430,1
cell cycle,128586,25432,1
tubulin polymerase,128586,25432,1
carbohydrate binding domain,128740,25441,1
"cell-matrix interaction, malignant transformation, and cell adhesion",128933,25453,1
Evading host response to virus,129111,25462,1
RNA binding,129111,25462,1
Evading host response to virus,129130,25463,1
RNA binding,129130,25463,1
"Unknown, though presumed to regulate the PKD2 channel",129203,25467,1
immune protein;  membrane binding protein,129443,25481,1
Regulation of muscle contraction,129732,25495,1
Cardiac muscle contraction,130066,25511,1
Elicits gastrin release and regulates gastric acid secretion and enteric motor function.,130225,25519,1
Mediates on neurotransmission and neuromodulation.,130225,25519,1
Plays a central role in regulation of the neuroendocrine and autonomic systems,130225,25519,1
Regulate growth and/or differentiation of different human tumors.,130225,25519,1
Elicits gastrin release and regulates gastric acid secretion and enteric motor function.,130245,25520,1
Mediates on neurotransmission and neuromodulation.,130245,25520,1
Plays a central role in regulation of the neuroendocrine and autonomic systems,130245,25520,1
Regulate growth and/or differentiation of different human tumors.,130245,25520,1
Elicits gastrin release and regulates gastric acid secretion and enteric motor function.,130262,25521,1
Mediates on neurotransmission and neuromodulation.,130262,25521,1
Plays a central role in regulation of the neuroendocrine and autonomic systems,130262,25521,1
Regulate growth and/or differentiation of different human tumors.,130262,25521,1
Elicits gastrin release and regulates gastric acid secretion and enteric motor function.,130279,25522,1
Mediates on neurotransmission and neuromodulation.,130279,25522,1
Plays a central role in regulation of the neuroendocrine and autonomic systems,130279,25522,1
Regulate growth and/or differentiation of different human tumors.,130279,25522,1
Elicits gastrin release and regulates gastric acid secretion and enteric motor function.,130296,25523,1
Mediates on neurotransmission and neuromodulation.,130296,25523,1
Plays a central role in regulation of the neuroendocrine and autonomic systems,130296,25523,1
Regulate growth and/or differentiation of different human tumors.,130296,25523,1
Elicits gastrin release and regulates gastric acid secretion and enteric motor function.,130316,25524,1
Mediates on neurotransmission and neuromodulation.,130316,25524,1
Plays a central role in regulation of the neuroendocrine and autonomic systems,130316,25524,1
Regulate growth and/or differentiation of different human tumors.,130316,25524,1
Elicits gastrin release and regulates gastric acid secretion and enteric motor function.,130333,25525,1
Mediates on neurotransmission and neuromodulation.,130333,25525,1
Plays a central role in regulation of the neuroendocrine and autonomic systems,130333,25525,1
Regulate growth and/or differentiation of different human tumors.,130333,25525,1
"DNA repair, Transcription regulation",130628,25540,1
"virulence, suppression of host transcription",130629,25540,2
peroxidase,130901,25557,1
Signalling,131188,25572,1
Neurotrophin reception,132345,25646,1
cell death/survival regulation,132345,25646,1
Neurotrophin reception,132359,25647,1
cell death/survival regulation,132359,25647,1
Neurotrophin reception,132373,25648,1
cell death/survival regulation,132373,25648,1
specific ligand binding,132685,25661,1
ADP-ribosyltransferase,132803,25665,1
Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (MALT1) has a central role in transcription factor NF- B signaling.,132992,25674,1
"Restriction endonuclease, type II",133452,25701,1
RNA encapsidation,133519,25705,1
Histamine-binding,133930,25727,1
Serotonin-binding,133930,25727,1
Histamine-binding,133952,25728,1
Serotonin-binding,133952,25728,1
"Restriction endonuclease, type II",134375,25752,1
kinase,134459,25756,1
Telomerase reverse transcriptase,134701,25770,1
RNA recognition,134869,25779,1
transcription factor,135111,25792,1
cell-mediated immunity,135472,25809,1
"Beta-lactamase catalyses the hydrolysis of beta-lactam rings, thereby providing bacterial hosts with resistance against beta-lactam antibiotics.",135647,25821,1
Protease- Degrades Elastin and alpha1-antitrypsin,136269,25859,1
"Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis.",136297,25860,1
"Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis.",136318,25861,1
protein involved in the LPS transport pathway,136455,25869,1
RNA-binding protein,136699,25885,1
calcium binding protein of the troponin complex,136974,25896,1
calcium binding,136990,25897,1
Voltage gated channel anchoring,137105,25902,1
actin binding,137105,25902,1
synapse organization,137105,25902,1
synaptic plasticity,137105,25902,1
Regulatory natively disordered N-terminal region of a ser/thr kinase,139268,26027,1
metal coordination,139304,26029,1
metal coordination,139322,26030,1
ADP-ribosyltransferase,139569,26044,1
Transcription repressor of the genetic switch from temperated TP901-1 bacteriophage,139833,26058,1
"key virulence factor of Mycobacterium tuberculosis, which is the causative organism of tuberculosis",140747,26513,1
Anti-viral,141046,26531,1
Ribonucleolytic catalysis,141046,26531,1
mannose-specific lectin on the tip of bacterial type 1 pili,141184,26541,1
Y-family translesion/bypass polymerase,141441,26564,1
receptor,141473,26565,1
Chaperone to type III secretion system tip protein PcrV,141843,26591,1
chaperone to type III secretion system tip protein LcrV,141857,26592,1
cytoskeletal protein,141876,26593,1
transcription factor,141951,26599,1
chaperone,142487,26636,1
stress protein,142487,26636,1
molecular chaperone,142563,26640,1
small heat shock protein,142563,26640,1
epidermis development,142606,26642,1
keratinization,142606,26642,1
keratinocyte differentiation,142606,26642,1
"protein binding, bridging",142606,26642,1
androgene nuclear receptor,142654,26645,1
transcription factor,142685,26647,1
transcriptional regulator,142854,26658,1
"Proto-oncogenic transcription factor, universal regulator of cell growth, apoptosis and proliferation in both normal and tumor cells.",142928,26662,1
"Proto-oncogenic transcription factor, universal regulator of cell growth, apoptosis and proliferation in both normal and tumor cells.",142944,26663,1
protein interaction domain,143009,26672,1
transcriptional activation domain,143009,26672,1
regulates spindle orientation during mitosis,143181,26684,1
"Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis.",143316,26693,1
"Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis.",143333,26694,1
"Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis.",143354,26695,1
Substrate recognition domain of a ubiquitin ligase,143387,26698,1
HCV RNA replication and viral particles production.,143433,26702,1
HCV RNA replication and viral particles production.,143434,26702,2
HCV RNA replication and viral particles production.,143435,26702,3
HCV RNA replication and viral particles production.,143436,26702,4
activation of NF-kappaB-inducing kinase activity,143504,26708,1
inflammatory response,143504,26708,1
activation of NF-kappaB-inducing kinase activity,143519,26709,1
inflammatory response,143519,26709,1
C-terminal disordered 80 amino acids of Yeast transcription factor.,143802,26719,1
LDLa-LRR linker of RXFP1 contains relaxin binding site,143830,26721,1
Calcium-binding protein,143869,26723,1
DNA binding transcription factor,143978,26730,1
DNA binding transcription factor,143992,26731,1
CD19 promoter site,143993,26731,2
CD19 promoter site,143994,26731,3
Tyrosine kinase receptor,144105,26740,1
tRNA m1A22 methyltransferase,144187,26744,1
Pilin Polymerization,144208,26745,1
transpeptidase,144208,26745,1
hydrolase,144239,26748,1
pancreatic ribonuclease,144239,26748,1
stimulator of angiogenesis,144239,26748,1
Biosynthetic monooxygenase,144258,26750,1
Antigen recognition,144278,26751,1
T-cell activation,144278,26751,1
T-cell receptor,144278,26751,1
Antigen recognition,144279,26751,2
T-cell activation,144279,26751,2
T-cell receptor,144279,26751,2
"binding pocket for NAD+ metabolites: ADP-ribose, PAR and negatively charged molecules as RNA",144314,26753,1
viral replication,144314,26753,1
membrane transporter,144350,26755,1
signalling scaffold,144350,26755,1
Kinase,144408,26758,1
Mitogen-Activated Protein Kinase,144408,26758,1
CELL CYCLE SIGNALLING,144444,26760,1
"Skp1 is an adaptor protein in the Skp1-Cullin1-F-box (SCF) RING E3 ligase. 
SCF E3 ligase is involved in the polyubiquitination of protein molecules 
involved in various cellular processes.",144520,26765,1
Calvin cycle regulatory protein,144609,26770,1
TDP2 hydrolyzes 5'-tyrosyl DNA adducts formed by abortive topoisomerase II cleavage complexes to allow error-free repair of DNA double-strand breaks,144625,26771,1
Adhesion receptor - cytosolic domain,144642,26772,1
Component of erythrocyte cytoskeleton,144658,26773,1
Cytokine,144796,26780,1
Calcium binding,144968,26791,1
Carbohydrate binding,144968,26791,1
Pathogen uptake receptor,144968,26791,1
Hormone,145035,26794,1
Hormone,145054,26795,1
Hormone,145073,26796,1
Hormone,145092,26797,1
Hormone,145111,26798,1
Hormone,145130,26799,1
Cell adhesion,145206,26803,1
"Molecular chaperone, assists in protein refolding, protein trafficking and protein degradation",145414,26815,1
Binding domain of Ubiquitin ligase to Hsp70/Hsp90,145451,26818,1
Ubiquitin ligase tetratricopeptide repeat domain,145468,26819,1
C-terminus of heat shock protein,145469,26819,2
trp aporepressor,145501,26821,1
Involved in both single and double strand break DNA-repair. PARP3 is a sensor of nicked nucleosomes.,145732,26834,1
C-terminal domain of Pr55Gag,145891,26843,1
immunoglobin binding domain,145926,26845,1
"methyltransferase enzyme, inactivates catecholamine neurotransmitters",145984,26848,1
"methyltransferase enzyme, inactivates catecholamine neurotransmitters",146038,26851,1
Type iv secretion systems are responsible for transfer of toxins and conjugative plasmids.,146060,26852,1
VirB8 is a subunit from type iv secretion system complex in bacteria and is important for the function of the complex.,146060,26852,1
plant photosensor,146089,26854,1
binding to proline-rich motifs,146281,26870,1
Variable domain of light chain immunoglobulin molecule,146410,26879,1
Wildtype R3 binds to vinculin and RIAM and is involved in cell adhesion,146427,26880,1
adhesion protein,146486,26884,1
glucose metabolism,146564,26889,1
radical scavenger,146621,26893,1
radical scavenger,146636,26894,1
co-factor of hRSV RNA dependent RNA polymerase,146666,26902,1
Co-factor of the RNA dependent RNA polymerase of hRSV,146681,26903,1
Co-factor of hRSV RNA dependent RNA polymerase,146696,26904,1
Co-factor of hRSV RNA dependent RNA polymerase,146711,26905,1
Nucleocapsid-binding domain of hRSV phosphoprotein,146727,26906,1
flagellar assembly,146758,26908,1
flagellar assembly,146759,26908,2
contributes to opening the beta-clamp for loading on DNA,146774,26909,1
"Component of the ESCRT-I complex, a regulator of vesicular trafficking process. 
Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic 
ubiquitinated cargos into multivesicular bodies (MVBs). Plays a role in the 
proteasomal degradation of ubiquitinated cell-surface proteins, such as EGFR and BST2.",146844,26914,1
Cytokine,146875,26916,1
co-chaperone,146917,26920,1
Alternative splicing,146947,26922,1
Binds to DNA and plays an important role in Nucleoid Formation,147241,26942,1
Regulate DNA Transactions,147241,26942,1
Signaling protein,147257,26943,1
One of the U6 snRNA binding domains of human SART3.,147343,26948,1
Cold stress related protein,147357,26949,1
Transcription factor: acts as both an activator and repressor.,147387,26953,1
Transcription factor,147456,26957,1
transcriptional repressor,147485,26959,1
SUMO-specific protease 4 (SUSP4),147529,26961,1
Bacterial enterotoxin,147624,26966,1
Part of Skp1/Cullin-1/F-box protein (SCF) complex involved in ubiquitin degradation pathway,147656,26968,1
Lipid tramsfer protein,147690,26970,1
Lipid tramsfer protein,147704,26971,1
Protein binds histamine,147910,26983,1
Interaction with various targets in biological systems,147964,26986,1
disulfide reductase activity,147964,26986,1
Dephosphorylation of NFAT,147979,26990,1
"Inhibitor of Calmodulin activated cyclic 3',5'-nucleotide phosphodiesterase",147979,26990,1
ionic channel,148013,26992,1
ionic channel,148033,26993,1
Polyketide synthase module communication,148409,27016,1
calcium sensor,148426,27017,1
protein phosphatase,148427,27017,2
"receptor activation, ligand binding",148449,27019,1
"PGK catalyses the formation of ATP from ADP and 1,3-bisphosphoglycerate in glycolysis",148482,27022,1
N-terminal polyA/polyQ region of the bHLH transcription factor Ascl1,148505,27023,1
"N-terminal domain of Ascl1 bHLH transcription factor, containing a polyA/polyQ stretch and a disordered region.",148522,27024,1
Basic Helix-Loop-Helix (bHLH) DNA binding domain of Ascl1. Fragment 114-183 of the full length sequence.,148539,27025,1
Basic Helix-Loop-Helix (bHLH) DNA binding domain and disordered C-terminal domain of Ascl1. Fragment 118-236 of the full length sequence.,148556,27026,1
transcriptional repressor,148587,27028,1
peptidyl prolyl isomerases,148663,27033,1
Hsp90,148726,27037,1
chaperone,148726,27037,1
Hsp90,148748,27038,1
chaperone,148748,27038,1
Eye lens protein,148769,27039,1
Member of the thioredoxin family. Involved in regulation of oxidative stress in trypanosoma brucei.,148919,27049,1
Member of the thioredoxin family. Involved in regulation of oxidative stress in Trypanosoma brucei.,148941,27050,1
Centriole assembly,149030,27056,1
Structural protein,149030,27056,1
"Microtubule binding, kinetochore scafolding protein, Protein Phosphatase 1 binding",149046,27057,1
"Microtubule binding, kinetochore scafolding protein, Protein Phosphatase 1 binding",149178,27066,1
Beta-lactamase,149196,27067,1
RNA-dependent RNA polymerase,149289,27073,1
catalytic domain of AA10 family lytic polysaccharide monooxygenase,149380,27078,1
family 2 carbohydrate binding module,149381,27078,2
family AA10 lytic polysaccharide monooxygenase with a family 2 carbohydrate binding module,149382,27078,3
Tyrosine Kinase,149472,27082,1
Staphylococcus aureus ribosome Hibernation Promoting Factor,149525,27085,1
translation factor,149629,27090,1
glycosyl-transferase,149648,27091,1
regulation of gamma-tubulin ring complexes,149684,27093,1
Calcium sensor,149701,27094,1
Sodium channel,149702,27094,2
Calcium sensor,149719,27095,1
Sodium channel,149720,27095,2
"Fatty acid-binding protein, adipocyte.",149739,27096,1
"polysaccharide binding, biofilm formation",150143,27130,1
"MSP2 of the P. falciparum is a potential component of a malaria vaccine. 
The exact role of MSP2 is not clear but it has been shown to be essential 
for growth in vitro of asexual parasites.",150201,27134,1
pre-mRNA splicing; helicase,150220,27135,1
RNA binding domain,150303,27140,1
Bacterial ferric-pseudobactin BN7/BN8 receptor N-terminal signaling domain,150318,27141,1
"Recognizes and binds histone 3 (H3) tail when Lys9 (K9) is trimethylated, leading to epigenetic repression.",150410,27145,1
ATP:GMP phosphotransferase,150487,27151,1
"Binding pocket for NAD+ metabolites: ADP-ribose, PAR and negatively charged molecules such as RNA",150606,27158,1
"Viral replication, Virulence",150606,27158,1
Peptidyl Prolyl Isomerase,150623,27159,1
"Flap endonuclease hydrolyses the phosphodiester of a 5' DNA sequence from a structure called a DNA flap. 
The DNA flap structure occurs in double-stranded DNA containing a single-stranded break where the 5' portion 
of the downstream strand is too long and overlaps the 3' end of the upstream strand. 
Flap endonucleases cleave the downstream strand of the overlap flap structure precisely after the first 
base-paired nucleotide, creating a ligatable nick.",150639,27160,1
ser/thr kinase,150721,27167,1
ser/thr kinase,150744,27168,1
catalyses the reversible interconversion of beta-glucose 1-phosphate and beta-glucose 6-phosphate,150848,27174,1
catalyses the reversible interconversion of beta-glucose 1-phosphate and beta-glucose 6-phosphate,150867,27175,1
Essential calcium-binding protein,151082,27190,1
Initiation and propagation of action potentials,151083,27190,2
Establishment and maintenance of cell poarity,151196,27197,1
Transcription Activator,151334,27207,1
non-selective channel,151533,27219,1
oxidoreductase,151580,27224,1
B-cell signaling,151641,27228,1
formation of k-fibres in mitosis,151734,27235,1
regulation microtubule polymerisation,151734,27235,1
carbohydrate-binding protein; lectin,151768,27237,1
antigen presentation,151955,27248,1
cellular immunity,151955,27248,1
class I major histocompatibility complex,151955,27248,1
antigen presentation,151974,27249,1
cellular immunity,151974,27249,1
class I major histocompatibility complex,151974,27249,1
Involved in HCV RNA replication,152312,27270,1
kinase,152368,27273,1
Kinase,152385,27274,1
Kinase,152386,27274,2
Beta subunit of PreTCR or TCR with mutations with ligand recognition loop.,152492,27280,1
Beta subunit of PreTCR or TCR with mutations with ligand recognition loop.,152510,27281,1
Peptide binding subunit of immunological peptide presentation complex.,152563,27285,1
subunit of immunological peptide presentation complex,152563,27285,1
G-protein coupled receptor,152672,27292,1
G-protein coupled receptor,152687,27293,1
G-protein coupled receptor,152704,27294,1
G-protein coupled receptor,152719,27295,1
G-protein coupled receptor,152736,27296,1
Gs-mimetic,152736,27296,1
Gs-mimetic,152737,27296,2
G-protein coupled receptor,152752,27297,1
Gs-mimetic,152752,27297,1
Gs-mimetic,152753,27297,2
heat acclimation,152849,27303,1
positive regulation of transcription,152849,27303,1
regulation of transcription,152849,27303,1
response to UV-B,152849,27303,1
response to heat,152849,27303,1
response to hydrogen peroxide,152849,27303,1
response to water deprivation,152849,27303,1
transcription,152849,27303,1
Peptidyl Carrier Protein,152867,27304,1
Transport Protein,152867,27304,1
Haem binding protein / haemophore,152950,27313,1
"endocellulose, without the cellulose binding module (CBM)",152974,27314,1
identical protein binding,153020,27317,1
pathogenicity,153020,27317,1
transcription factor,153034,27320,1
zinc sensing,153049,27321,1
zinc transport,153049,27321,1
"Proteasomal shuttle protein, autophagy, protein quality control",153264,27339,1
Contains NLS.,153279,27341,1
"Interacts with RNA, Aly/REF and SRPK1.",153279,27341,1
VirB10 forms part of core complex in Type IV secretion system (T4SS),153294,27342,1
Hydro-lyase catalyzing the first step of the transsulfuration pathway.,153442,27351,1
a putative metal-binding protein,153492,27354,1
"ubiquitination, protein modifications",153525,27356,1
Anti-inflammatory peptide,153544,27357,1
Immunomodulatory peptide,153544,27357,1
DNA binding inhibitor,153561,27358,1
regulation of signal transduction pathways,153576,27359,1
regulation of signal transduction pathways,153624,27362,1
DNA-binding protein,153661,27364,1
transcriptional regulator,153661,27364,1
epigenetic regulation of gene expression,153662,27364,2
DNA-binding protein,153696,27366,1
transcriptional regulator,153696,27366,1
epigenetic regulation of gene expression,153697,27366,2
DNA-binding protein,153716,27367,1
transcriptional regulator,153716,27367,1
epigenetic regulation of gene expression,153717,27367,2
DNA-binding protein,153736,27368,1
transcriptional regulator,153736,27368,1
epigenetic regulation of gene expression,153737,27368,2
DNA-binding protein,153756,27369,1
transcriptional regulator,153756,27369,1
epigenetic regulation of gene expression,153757,27369,2
epigenetic regulation of gene expression,153758,27369,3
DNA-binding protein,153777,27370,1
transcriptional regulator,153777,27370,1
epigenetic regulation of gene expression,153778,27370,2
epigenetic regulation of gene expression,153779,27370,3
DNA-binding protein,153798,27371,1
transcriptional regulator,153798,27371,1
epigenetic regulation of gene expression,153799,27371,2
epigenetic regulation of gene expression,153800,27371,3
DNA-binding protein,153819,27372,1
transcriptional regulator,153819,27372,1
epigenetic regulation of gene expression,153820,27372,2
epigenetic regulation of gene expression,153821,27372,3
Tyr protein kinase,153840,27373,1
Ubl conjugation pathway,153963,27380,1
transcription,153963,27380,1
transcription regulation,153963,27380,1
substrate recognition,153981,27381,1
chaperone,154186,27392,1
chemokine-related signal transduction,154200,27393,1
TRAIL Receptor (TRAILR2),154341,27400,1
Binding Adaptor protein to enhance the motility of Dynein over microtubules,154359,27401,1
Wnt signalling,154374,27402,1
"Flap endonuclease hydrolyses the phosphodiester of a 5' DNA sequence from a
structure called a DNA flap. The DNA flap structure occurs in double-stranded
DNA containing a single-stranded break where the 5' portion of the downstream
strand is too long and overlaps the 3' end of the upstream strand. Flap
endonucleases cleave the downstream strand of the overlap flap structure
precisely after the first base-paired nucleotide, creating a ligatable nick.",154389,27403,1
Cytokine,157109,27574,1
Growth Factor,157109,27574,1
Putative methyltransferase associated to Williams-Beuren Syndrome,157175,27578,1
Substrate binding protein of ABC transporter,164059,28056,1
"Flap endonuclease hydrolyses the phosphodiester of a 5' DNA sequence from a
structure called a DNA flap. The DNA flap structure occurs in double-stranded
DNA containing a single-stranded break where the 5' portion of the downstream
strand is too long and overlaps the 3' end of the upstream strand. Flap
endonucleases cleave the downstream strand of the overlap flap structure
precisely after the first base-paired nucleotide, creating a ligatable
nick.""",154405,27404,1
Activates ATPase activity of HSP70,154424,27405,1
Binding to HSP70,154424,27405,1
Delivers substrate to HSP70,154424,27405,1
Pheromone of Euplotes raikovi,154438,27406,1
dRP lyase,154452,27407,1
nucleotidyltransferase,154452,27407,1
dRP lyase,154484,27409,1
nucleotidyltransferase,154484,27409,1
dRP lyase,154508,27410,1
nucleotidyltransferase,154508,27410,1
DNA damage repair,154550,27412,1
Transcription factor,154550,27412,1
Selectively catalyzes the oxidative demethylation of the internal mRNA modification N6-methyladenosine,154567,27413,1
Putative methyltransferase associated to Williams-Beuren Syndrome,154626,27417,1
Memory and cognition,154770,27429,1
Organ growth control,154770,27429,1
Receptor trafficking,154770,27429,1
Memory and cognition,154787,27430,1
Organ growth control,154787,27430,1
Receptor trafficking,154787,27430,1
Scaffold protein,154838,27432,1
Stabilize Phage L capsid shell against internal DNA pressure,154889,27435,1
cytosolic glycosyltransferase,155055,27446,1
zinc sensing transcriptional regulator,155071,27447,1
zinc sensing transcriptional regulator,155103,27448,1
SAM/SAH binding riboswitch,155180,27452,1
transcriptional repressor,155235,27455,1
transcriptional repressor,155296,27459,1
repetitive domain of spider dragline silk functions to form beta-sheet of silk fiber,155325,27460,1
proteasomal degradation,155422,27466,1
protein modifiaction,155422,27466,1
protein degradation,155437,27467,1
protein modification,155437,27467,1
oxidoreductase,155473,27469,1
oxidoreductase,155490,27470,1
toxin antitoxin,155507,27471,1
"E3 ligase, ubiquitylation",155587,27477,1
antibiotic,155611,27478,1
antibiotic,155629,27479,1
Bacterial cell wall precursor,155647,27480,1
antibiotic,155647,27480,1
Inhibitor of protein phosphatase 2A,155680,27482,1
Multifunctional regulator of viral gene expression,155696,27483,1
Nuclear export of viral mRNAs,155696,27483,1
Accumilation and nuclear export of viral mRNA,155711,27484,1
Splicing modulation,155711,27484,1
serine protease inhibitor,155791,27491,1
Innate immune system evasion,155910,27498,1
Viral replication and transcription,155910,27498,1
nucleo-cytoplasmic trafficking,155910,27498,1
Antibiotic stress sensing histidine kinase,155995,27502,1
bacterial signaling,155995,27502,1
ribosome elongation factor,156010,27503,1
plant virus,156024,27506,1
Ubiquitin ligation,156045,27508,1
Fatty acid binding; transport,156059,27509,1
Fatty acid binding and transport,156075,27510,1
ubiquitin ligation,156091,27511,1
ubiquitination,156105,27512,1
"Acts downstream of various receptor and cytoplasmic protein tyrosine kinases to
participate in the signal transduction from the cell surface to the nucleus.
Positively regulates MAPK signal transduction pathway (PubMed:28074573).
Dephosphorylates GAB1, ARHGAP35 and EGFR (PubMed:28074573). Dephosphorylates
ROCK2 at 'Tyr-722' resulting in stimulatation of its RhoA binding activity.
Dephosphorylates CDC73 (PubMed:26742426).",156227,27520,1
"Acts downstream of various receptor and cytoplasmic protein tyrosine kinases to
participate in the signal transduction from the cell surface to the nucleus.
Positively regulates MAPK signal transduction pathway (PubMed:28074573).
Dephosphorylates GAB1, ARHGAP35 and EGFR (PubMed:28074573). Dephosphorylates
ROCK2 at 'Tyr-722' resulting in stimulatation of its RhoA binding activity.
Dephosphorylates CDC73 (PubMed:26742426).",156248,27521,1
"Acts downstream of various receptor and cytoplasmic protein tyrosine kinases to
participate in the signal transduction from the cell surface to the nucleus.
Positively regulates MAPK signal transduction pathway (PubMed:28074573).
Dephosphorylates GAB1, ARHGAP35 and EGFR (PubMed:28074573). Dephosphorylates
ROCK2 at 'Tyr-722' resulting in stimulatation of its RhoA binding activity.
Dephosphorylates CDC73 (PubMed:26742426).",156268,27522,1
DNA binding,156287,27523,1
F-actin binding,156339,27526,1
beta-catenin binding,156339,27526,1
proteasomal degradation,156353,27527,1
Believed to have a role in Human brain evolution.,156446,27533,1
DNA damage Repair protein; PALB2 = Partner and localizer of BRCA2,156462,27534,1
coiled-coil domain interacts with BRCA1 as part of the BRCA2-PALB2-BRCA1 DNA repair complex,156462,27534,1
ribonuclease,156609,27542,1
ribonuclease,156638,27544,1
ribonuclease,156652,27545,1
ribonuclease,156666,27546,1
"gene transcription, splicing, mRNA processing, and mRNA stability.",156712,27549,1
Hemoglobin binding domain,156728,27550,1
apoptosis,156814,27556,1
electron transport,156814,27556,1
The assembly binds to DNA to perform various DNA dependent Cellular activities,156830,27557,1
Adapter Protein,156927,27563,1
Frontotemporal dementia and amyotrophic lateral sclerosis,156960,27565,1
Lysosome and late endosome membrane protein,156960,27565,1
"Bacteriocin, antibiotic",157071,27572,1
"Bacteriocin, antibiotic",157072,27572,2
Wt SUMO1 is a Ubiquitin like post translational modifier.,157095,27573,1
Peptidyl-prolyl cis-trans isomerase specific for phospho-Ser/Thr-Pro motifs,157197,27579,1
DNA binding,157212,27580,1
rotavirus penetration,157387,27591,1
Rotavirus Penetration,157403,27592,1
Chaperone of the Csu biofilm-mediating pili of Acinetobacter baumannii,157436,27594,1
Major pilus subunit from the Csu biofilm-mediating pili of Acinetobacter baumannii,157437,27594,2
DNA binding,157461,27595,1
chromatin remodelling,157461,27595,1
participates in the antigen recognition,157564,27602,1
Centromeric Protein,157583,27603,1
protein kinase,157597,27605,1
Centriole assembly,157634,27607,1
"Part of the nsP3, part of the viral replication machinery, ADP-r binding protein, RNA binding protein",157709,27612,1
"beta-lactamase, hydrolase",157770,27617,1
26S proteasome subunit,157789,27618,1
interacts with BRCA2 DNA repair protein,157789,27618,1
interacts with Thp1 subunit of the TREX-2 complex,157789,27618,1
viral protein,158051,27634,1
"Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. 
May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.",158121,27637,1
"Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. 
May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.",158137,27638,1
Binds to voltage-gated potassium channel KCNQ1 to create a constitutively open channel,158182,27640,1
Activator,158282,27647,1
DNA-binding,158282,27647,1
Activator,158302,27648,1
DNA-binding,158302,27648,1
zinc sensing transcriptional regulator,158396,27655,1
zinc sensing transcriptional regulator,158421,27656,1
DNA sliding clamp that tethers DNA polymerases to the genomic template during replication,158460,27661,1
ubiquitin conjugating enzyme,158491,27664,1
ubiquitin conjugating enzyme,158492,27664,2
RNA binding,158562,27669,1
mRNA binding,158578,27670,1
mRNA binding,158594,27671,1
Potassium Channel,158672,27676,1
cell cycle arrest,158689,27677,1
chromatin remodelling,158689,27677,1
Potassium Channel; High-P0 mode probability,158705,27678,1
Potassium Channel; Low-P0 mode probability,158722,27679,1
Potassium Channel; Flickery mode,158752,27680,1
Chaperone,158769,27681,1
Small heat shock protein (sHSP),158769,27681,1
pH dependent silk formation,158810,27683,1
"Chemokines are the small proteins that play roles in many pathophysiological activities including wound healing, inflammation, angiogenesis, and cancer metastasis etc.",158827,27684,1
"They perform these functions by interacting with their cellular partners namely, G-protein coupled receptor (GPCRs) present on the leukocytes and the glycosaminoglycans (GAGs) present on endothelial cells.",158827,27684,1
Cytokine,158856,27688,1
Chromatin compaction,158995,27699,1
non-receptor protein tyrosine kinase,159148,27708,1
TRANSPORT,159441,27724,1
GTPase,159478,27726,1
"UL49.5 protein blocks the transporter associated with antigen processing (TAP).
The interaction of the UL49.5 protein with the TAP complex blocks conformational
rearrangements in TAP required for peptide translocation into the endoplasmic
reticulum (ER). In addition, UL49.5 induces degradation of the transporter and
the UL49.5 protein itself (18). A truncated form of the UL49.5 protein lacking
the cytoplasmic tail can still block the translocation of peptides, but it fails
to trigger degradation of the TAP complex.",159496,27728,1
anti-inflammatory cytokine,159515,27729,1
"UL49.5 protein blocks the transporter associated with antigen processing (TAP).
The interaction of the UL49.5 protein with the TAP complex blocks conformational
rearrangements in TAP required for peptide translocation into the endoplasmic
reticulum (ER). In addition, UL49.5 induces degradation of the transporter and
the UL49.5 protein itself (18). A truncated form of the UL49.5 protein lacking
the cytoplasmic tail can still block the translocation of peptides, but it fails
to trigger degradation of the TAP complex.",159531,27730,1
cis-trans peptidyl-prolyl isomerase,159550,27732,1
cis-trans peptidyl-prolyl isomerases,159571,27733,1
cis-trans peptidyl-prolyl isomerases,159594,27734,1
cis-trans peptidyl-prolyl isomerases,159615,27737,1
cis-trans peptidyl-prolyl isomerases,159638,27738,1
cis-trans peptidyl-prolyl isomerase,159659,27739,1
Potassium transport,159752,27746,1
ADP ribosylation,159770,27747,1
protein-protein interaction,159770,27747,1
Entry of nuclease toxin into bacterial cytoplasm,159841,27753,1
metI dependent bacterial cytoplasm entry,159841,27753,1
Entry of nuclease toxin into bacterial cytoplasm,159856,27754,1
metI dependent bacterial cytoplasm entry,159856,27754,1
Entry of nuclease toxin into bacterial cytoplasm,159871,27755,1
metI dependent bacterial cytoplasm entry,159871,27755,1
guanine nucleotide exchange factors,159941,27761,1
Histine Kinase,160020,27768,1
Phosphorelay,160020,27768,1
intron,160034,27769,1
pre-mRNA splicing,160034,27769,1
U2 small nuclear RNA,160035,27769,2
pre-mRNA splicing,160035,27769,2
intron,160054,27770,1
pre-mRNA splicing,160054,27770,1
U2 small nuclear RNA,160055,27770,2
pre-mRNA splicing,160055,27770,2
RNA binding protein,160162,27777,1
CUE domain (recruitment domain) from chromatin remodeller,160215,27780,1
"The Grb2-SH2 domain is a key factor in signaling pathways, making specific recognition of phosphotyrosines in partner proteins.",160234,27781,1
iron uptake,164059,28056,1
CUE domains (recruitment domains) from chromatin remodeller,160296,27785,1
Na+/Ca2+ exchanger,160343,27787,1
specific ligand binding,160467,27794,1
"Promotes orthogonal branching of actin filaments and links actin filaments to membrane glycoproteins. 
Anchors various transmembrane proteins to the actin cytoskeleton and serves as a scaffold for a wide range of cytoplasmic signaling proteins. 
Interaction with FLNA may allow neuroblast migration from the ventricular zone into the cortical plate. 
Tethers cell surface-localized furin, modulates its rate of internalization and directs its intracellular trafficking (By similarity). 
Involved in ciliogenesis. Plays a role in cell-cell contacts and adherens junctions during the development of blood vessels, heart and brain organs. 
Plays a role in platelets morphology through interaction with SYK that regulates ITAM- and ITAM-like-containing receptor signaling, 
resulting in by platelet cytoskeleton organization maintenance.",160499,27795,1
This sequence results from a non-enzymatic post-translational modification that involves the formation of a non-natural protein with potential toxicity,160529,27797,1
"ubiquitin-conjugating enzyme, catalytic domain",160546,27798,1
ubiquitin-conjugating enzyme,160560,27799,1
ubiquitin-conjugating enzyme,160561,27799,2
Proton transport,160754,27812,1
Capsid assembly,161250,27845,1
C-type lectin,161376,27854,1
Calcium-dependent receptor,161376,27854,1
Pathogen recognition receptor (PRR),161376,27854,1
Involved in the late maturation steps of the ribosomal 30S subunit,161412,27857,1
signal transduction acting as a sensor-responder,161457,27860,1
signal transduction acting as a sensor-responder,161532,27865,1
Carrier protein in fatty acid biosynthesis.,161628,27872,1
Performs the extension step of fatty acid biosynthesis.,161629,27872,2
beta-ketoacyl-[acyl carrier protein] synthase I,161629,27872,2
Inhibitor of amyloid aggregation,161652,27873,1
Carrier protein in fatty acid biosynthesis.,161678,27874,1
Performs the extension step of fatty acid biosynthesis.,161679,27874,2
beta-ketoacyl-[acyl carrier protein] synthase I,161679,27874,2
Phosphotransfer domain,161831,27882,1
Beta-lactamase,161914,27888,1
Beta-lactamase,161941,27890,1
antitermination protein,161964,27893,1
bacterial metabolism of sugars,161964,27893,1
"Protein phosphatase 2A inhibitor, regulator of mitotic cell cycle.",162090,27911,1
"Protein phosphatase 2A inhibitor, regulator of mitotic cell cycle.",162105,27912,1
transcription factor,162153,27915,1
transcription factor,162177,27916,1
The wild-type enzyme catalyses the reversible interconversion of beta-glucose 1-phosphate and beta-glucose 6-phosphate,162215,27920,1
Beta-lactamase,162348,27929,1
deglycase,162452,27943,1
Retinoic acid transportation,162482,27945,1
Retinoic Acid Receptors activation,162496,27946,1
deglycase,162512,27947,1
Dual specific human phosphatase; hydrolase,162559,27950,1
Co-chaperone,162608,27953,1
DNA DSB repair; ABC ATPase,162642,27955,1
DNA DSB repair; ABC ATPase,162643,27955,2
DNA repair; ABC ATPase,162658,27956,1
DNA repair; ABC ATPase,162659,27956,2
DNA repair; ABC ATPase,162674,27957,1
DNA repair; ABC ATPase,162675,27957,2
Genetic material,162690,27958,1
Genetic material,162691,27958,2
Assist dynein motility along microtubules,162841,27968,1
Microtubule-binding domains of dynactin,162841,27968,1
cytokine responsible for T-cell proliferation crucial to regulation of the immune response,162856,27969,1
cytokine responsible for T-cell proliferation crucial to regulation of the immune response,162871,27970,1
cytokine responsible for T-cell proliferation crucial to regulation of the immune response,162885,27971,1
Assist dynein motility along microtubules,162913,27973,1
Microtubule-binding domains of dynactin,162913,27973,1
cytokine responsible for T-cell proliferation crucial to regulation of the immune response,162931,27974,1
Reductase,162946,27975,1
p97 binding; ERAD pathway; mitophagy,162978,27977,1
cytotoxic effector,163021,27979,1
calcium sensing,163062,27981,1
calcium sensing,163082,27982,1
calcium sensing,163102,27983,1
"Hydrolase, Protease, Thiol protease",163122,27984,1
CCL2 is a member of CC chemokine family and recognized as a crucial chemotactic factor for monocyte/ microglia recruitment and migration towards the site of infection.,163137,27986,1
type I ribosome inactivating protein,163189,27989,1
phosphorelay signal transduction system,163218,27990,1
chaperone,163335,27998,1
chaperone,163350,27999,1
E3-ubiquitin ligase,163475,28011,1
QBP1 is a octapeptide that inhibits amyloid formation by polyglutamine and some other amyloid forming proteins,163546,28017,1
E3-ubiquitin ligase,163563,28019,1
Ribosomal proteins binding,163563,28019,1
p53 binding,163563,28019,1
E3-ubiquitin ligase,163596,28020,1
p53 binding,163596,28020,1
ribosomal proteins binding,163596,28020,1
Acts with HECT-type and RBR family E3 ubiquitin-protein ligases,163693,28028,1
E2 Ubiquitin-Conjugating Enzyme,163693,28028,1
Protein polyubiquitination,163693,28028,1
Alpha synuclein plays and important role in synaptic vesicle trafficking and neurotransmitter release,163888,28045,1
DNA DSB repair; ABC ATPase,163961,28049,1
DNA DSB repair; ABC ATPase,163962,28049,2
DNA DSB repair; ABC ATPase,163996,28051,1
DNA DSB repair; ABC ATPase,163997,28051,2
Endonuclease,164044,28054,1
Exonuclease,164044,28054,1
Substrate binding protein of ABC transporter,164075,28057,1
iron uptake,164075,28057,1
antifungal,164174,28066,1
Catalytic activity,164196,28077,1
The wild-type enzyme catalyses the reversible interconversion of beta-glucose 1-phosphate and beta-glucose 6-phosphate,164274,28095,1
The wild-type enzyme catalyses the reversible interconversion of beta-glucose 1-phosphate and beta-glucose 6-phosphate,164291,28096,1
The wild-type enzyme catalyses the reversible interconversion of beta-glucose 1-phosphate and beta-glucose 6-phosphate,164308,28097,1
major histocompatibility complex heavy chain; immune system,164348,28107,1
major histocompatibility complex light chain; immune system,164349,28107,2
HTLV-1 TAX9 peptide; major histocompatibility complex epitope,164350,28107,3
major histocompatibility complex heavy chain; immune system,164365,28108,1
major histocompatibility complex light chain; immune system,164366,28108,2
"molecular chaperone TAPBPR, tapasin homolog, immune system",164367,28108,3
Lysyl tRNA is aminoacylated for protein biosynthesis,164397,28113,1
Non-specific RNA binding domain of LysRS,164398,28113,2
immune system,164413,28114,1
major histocompatibility complex heavy chain,164413,28114,1
immune system,164414,28114,2
major histocompatibility complex light chain,164414,28114,2
NRASQ61K peptide,164415,28114,3
major histocompatibility complex neoepitope,164415,28114,3
DNA binding,192499,4024,1
transcription regulator,192499,4024,1
"Staphylococcal nuclease is a Ca2+ activated phosphodiesterase (extracellular)
which degrades both DNA and RNA to 3' nucleotides.",192907,4052,1
"Staphylococcal nuclease is a Ca2+ activated phosphodiesterase (extracellular)
which degrades both DNA and RNA to 3' nucleotides.",192926,4053,1
lipolytic enzyme,193032,4060,1
Oxygen storage protein,193047,4061,1
analogue of Insulin-Like Growth Factor I,193186,4069,1
cell adhesion molecule,193862,4109,1
LysN is the N-terminal anticodon binding domain of the lysyl-tRNA synthetase,194274,4134,1
Cell adhesion,194434,4143,1
Heterophilic binding,194434,4143,1
Homophilic binding,194434,4143,1
Transcription factor,196483,4248,1
Lymphoid enhancer element,196484,4248,2
Lymphoid enhancer element,196485,4248,3
Electron transfer,201177,4466,1
Microtubule end binding protein,211780,50003,1
"Furthermore, leptin plays a major role in other proteinopathies such as cancer, marked hyperphagia, impaired immune function, and inflammation.",211794,50004,1
"Leptin is a signalling hormone, mostly known for its role in energy expenditure and satiety.",211794,50004,1
Light-driven proton pump,211838,50009,1
Green negative reversibly photoswitchable fluorescent protein.,211856,50010,1
Metallo beta-lactamase,211887,50012,1
"The G-patch region of Spp2 binds to the DEAH-box ATPase Prp2, and both proteins together are essential for promoting the transition from the Bact to the catalytically active B* spliceosome",211917,50014,1
skin stability,211965,50020,1
Catalyzes the interconversion of ribulose-5-phosphate and ribose-5-phosphate,212036,50025,1
Natural Antimicrobial Compound,212065,50027,1
Viral Membrane Protein,212078,50028,1
"Genome stability, mitosis",212261,50077,1
"genome stability, mitosis",212274,50078,1
HECT E3 ligase,212320,50084,1
It catalyses formation of ROS,212401,50093,1
synthetic oligonucleotide,212659,50109,1
assembly factor of box C/D snoRNP,212696,50110,2
assembly factor of box C/D snoRNP,212697,50110,3
Several roles in the life cycle of Influenza A virus,212712,50113,1
Involved in Mycobacterium tuberculosis cell division,212743,50115,1
DNA Replication and Repair,212830,50121,1
potassium channel,212857,50123,1
Plays a role in cellular transport processes,212884,50126,1
"Plays a role in the regulation of neurite formation, neurite branching and the regulation of neurite length",212884,50126,1
Plays a role in the reorganization of the actin cytoskeleton and in neuron morphogenesis,212884,50126,1
Plays a role in the reorganization of the microtubule cytoskeleton,212884,50126,1
Required for normal excitatory and inhibitory synaptic transmission,212884,50126,1
Required for normal synaptic vesicle endocytosis,212884,50126,1
Several roles in the life cycle of Influenza A virus,212900,50127,1
Translation termination factor,213009,50131,1
Translation termination factor,213022,50132,1
Translation termination factor,213035,50133,1
Translation termination factor,213048,50134,1
potassium channel,213061,50135,1
functional amyloid; biofilm component,213075,50138,1
"Fowlpox virus resolvase (Fpr) is an endonuclease that cleaves a broad range of branched DNA structures, including the Holliday junction (HJ), with little sequence-specificity",213135,50141,1
virus,213161,50152,1
The full length protein is an electroneutral antiporter for K+ and H+ ions across the inner membrane.,213304,50166,1
Transcription factor,213634,50196,1
Cell wall-precursor binding antibiotic,213695,50202,1
Peptidoglycan precursor,213696,50202,2
FH8: affinity tag for lab use,213749,50205,1
HP63: actin binding domain,213749,50205,1
IDR: putative regulatory and structural role(s).,213749,50205,1
Chemotactic factor that attracts monocytes,213788,50207,1
Chemotactic factor that attracts monocytes,213803,50208,1
Mitochondrial intermembrane space chaperone subunit,213875,50213,1
Mitochondrial intermembrane space chaperone subunit,213876,50213,2
Sensor Histidine Kinase,213896,50214,1
kinetoplastid kinetochore protein,213909,50215,1
microtubule-binding,213909,50215,1
EF-G translocates the ribosome to allow access for the next tRNA to the next mRNA codon following peptide bond formation.,213993,50220,1
Confers resistance to the antibiotic fusidic acid,213994,50220,2
Translocation factor for bacterial protein sysnthesis,214011,50221,1
kinetoplastid kinetochore protein,214026,50228,1
microtubule-binding,214026,50228,1
kinetoplastid kinetochore protein,214044,50229,1
microtubule-binding,214044,50229,1
cAMP-dependent protein kinase A inhibitor,214092,50238,1
cAMP-dependent protein kinase A inhibitor,214167,50243,1
Substrate phosphorylation on Thr or Ser residues. Protein Kinase involves in cell signaling.,214168,50243,2
Cap-Binding protein,214307,50250,1
Translation initiation factor,214307,50250,1
SARS-CoV-2 main protease (Mpro),214454,50262,2
Functional amyloid formation linked to memory consolidation in Drosophila,214603,50274,1
"Calcium/calmodulin-dependent protein kinase that operates in the
calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx,
activates CREB-dependent gene transcription, regulates calcium-mediated
granulocyte function and respiratory burst and promotes basal dendritic growth
of hippocampal neurons. In neutrophil cells, required for cytokine-induced
proliferative responses and activation of the respiratory burst. Activates the
transcription factor CREB1 in hippocampal neuron nuclei. May play a role in
apoptosis of erythroleukemia cells.",214650,50277,1
Chorismate mutase (Hydroxyphenylpyruvate synthase) that converts chorismate to prephenate.,214717,50297,1
Splicing factor,214751,50299,1
Centrosome structural protein,214789,50300,1
endo-/exonuclease with preference for single-stranded DNA or RNA,214805,50301,1
Beta-2 microglobulin is proposed as regulator of the immune system,214818,50302,1
Beta-2 microglobulin provide structural assistance for HLA-1 receptor,214818,50302,1
"Structural protein, centriole assembly",214834,50308,1
Required for progression through the G1 and S phases of the cell cycle and for S phase entry,215025,50329,1
Substrate binding protein of ABC transporter,215059,50332,1
iron uptake,215059,50332,1
Substrate binding protein of ABC transporter,215075,50333,1
iron uptake,215075,50333,1
DNA-binding,215095,50334,1
RNA-binding,215095,50334,1
Required for histone gene transcription and progression through S phase,215113,50335,1
Has transcriptional repressor activity,215130,50336,1
Sub-structure of the SARS-CoV-2 leader sequence (5'-UTR).,215180,50340,1
transcription factor (DNA and RNA binding),215631,50405,1
"Receptor for growth hormone involved in e.g. regulating postnatal body growth. On ligand binding, couples to the JAK2/STAT5 pathway",216051,50478,1
serine protease inhibitor,216281,5056,1
growth factor,219393,5198,2
"The WW domain of Pin1 is residues 1-54 (20-73).
sequence: madeeklppgwekrmsrssgrvyyfnhitnasqwerpsgnsssggkngqgepar",221753,5305,1
"The catalytic domain of Pin1 is residues 44-163 (63-182).
sequence: ggkngqgeparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfes
lasqfsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte",221753,5305,1
catalyse redox reactions,228882,5622,1
Auxiliary replication factor,236306,5952,1
Transcription regulator,236306,5952,1
formation and maintenance of the myelin sheath,239575,6100,1
Phosphor transfer,240156,6133,1
blood lipid transport and metabolism,240325,6143,1
lipoprotien lipase cofactor,240325,6143,1
circadian clock protein,240860,6174,1
circadian clock protein,240861,6174,2
calcium binding,241396,6201,1
cell adhesion,241396,6201,1
Binds C12-HSL for activation of gene expression,242891,6271,1
protein interaction,243477,6297,1
Ran-GTP activating protein,243681,6305,1
Ran-GTP activating protein,243702,6306,1
photoreceptor,243988,6322,1
signaling protein,243988,6322,1
DNA binding,244647,6353,1
DNA replication,244647,6353,1
Fe(II) traffick and minimize the DNA damage caused by hydroxyl radicals,244800,6359,1
repressor,245095,6373,1
Energy Transducer,245140,6375,1
Iron Transport,245140,6375,1
degrades elastin,245428,6391,1
acylphoaphatase,245552,6398,1
Protein,246898,6457,1
molecular signalling,246912,6458,1
protein degradation,246912,6458,1
ATP dependent protein degradation,247065,6466,1
Mannan binding module,247208,6475,1
tumor,247461,6484,1
angiogensis,247461,6484,1
transport,247461,6484,1
protein degradation,247511,6488,1
transcription factor,248131,6522,1
"LDL receptor binding, lipoprotein binding, amyloid peptide binding",248148,6524,1
essential for pneumococcal virulence and pathogenesis in humans,248213,6528,1
mediates invasion of human cells by S. pneumoniae,248213,6528,1
Storage protein,248232,6529,1
DNA packaging,248335,6533,1
gene regulation,248335,6533,1
ribosomal frameshift induction,248504,6543,1
Cement protein,248912,6565,1
cytokine signalling,249208,6580,1
peptide from the mouse gp130 receptor,249209,6580,2
Involved in transport of protein in the chloroplast,249394,6589,1
Protein targeting,249475,6593,1
protease,249890,6615,1
antimicrobial,249904,6616,1
anti-protozoan,249904,6616,1
cytolytic peptide,249904,6616,1
antimicrobial,249938,6618,1
anti-protozoan,249938,6618,1
cytolytic peptide,249938,6618,1
antimicrobial,249956,6619,1
anti-protozoan,249956,6619,1
cytolytic peptide,249956,6619,1
heme binding protein,249988,6620,1
protein import; polypeptide receptor,250095,6626,1
antimicrobial,250126,6627,1
antiviral,250126,6627,1
cytotoxic,250126,6627,1
defence peptide,250126,6627,1
hemolitic,250126,6627,1
insecticidal,250126,6627,1
metalloregulatory protein,250497,6648,1
Transcription factor,250497,6648,1
hemolytic,250563,6650,1
hemolytic,250587,6651,1
Transcription factor,250632,6653,1
metalloregulatory protein,250632,6653,1
dsRNA binding,250667,6655,1
oxygen transport,251226,6683,1
oxygen transport,251227,6683,2
Possible Virulence Factor,251309,6688,1
Unknown,251309,6688,1
FNR catalyzes the transfer of electrons from ferredoxin to NADP+,251497,6695,1
last step of the photosynthetic I chain,251497,6695,1
hsp90 C-terminus,251517,6696,2
Unknown,251544,6698,1
Transcriptional regulation,251580,6700,1
Transcriptional regulation,251581,6700,2
Actin binding protein,252085,6730,1
de-ubiquitinase,252295,6742,1
alternative splicing regulation,252338,6745,1
membrane anchor,252538,6757,1
transcriptional activation,253011,6784,1
calcium dependent membrane binding domain,253091,6787,1
transcriptional activation,253107,6788,1
Inhibitor of JH in Corpora Allata (CA) of cockroach,253190,6791,1
Inhibitor of gut muscle contraction in cockroach,253190,6791,1
Inhibitor of JH in Corpora Allata (CA) of cockroach,253207,6792,1
Inhibitor of gut muscle contraction in cockroach,253207,6792,1
unknown,253282,6797,1
Iron(III) Dicitrate Transport Protein FecA,253393,6803,1
aspartate phosphotransferase,253502,6810,1
protease,253778,6823,1
DNA binding protein,253852,6826,1
expression inhibitor,253852,6826,1
gene regulator,253852,6826,1
mRNA interferase,253990,6833,1
toxin,253990,6833,1
antitoxin,253991,6833,2
purification tag,254082,6837,1
TEV protease cleavage site,254082,6837,1
Hydrolyzes beta-lactams.,254112,6838,1
palmitoyl group recognition,254177,6840,1
structural,254432,6856,1
structural,254476,6858,2
antimicrobial,254494,6859,1
anti-protozoan,254494,6859,1
cytolytic peptide,254494,6859,1
proton translocation,254871,6878,1
Potassium Channel Tetramerization Domain,254884,6879,1
immunosuppresion,255309,6902,1
prolyl isomerization,255309,6902,1
Transcription factor,255367,6905,1
Inhibits survival and neurite formation of cortical neurons in vitro; Binds zinc and copper(I)in brain; Metal storage protein,255426,6909,1
protein-protein interaction,255456,6911,1
disintegrin; bind to integrin alphaIIbbeta3,255517,6915,1
binds alpha-4,255598,6920,1
ubiquitin E3 ligase,255598,6920,1
IA current K+-channel blocker,255657,6924,1
Genome replication specificity determinant,255710,6928,1
Initiation of circovirus replication (nuclease),255710,6928,1
Termination of replication (ligase),255710,6928,1
RNA binding protein,255750,6930,1
RNA splicing factor,255750,6930,1
deubiquitylation,255859,6939,1
protein-protein interaction,255859,6939,1
Translation Initiation,255962,6946,1
trypsin inhibitor,256214,6963,1
co-chaperone,256373,6973,1
co-chaperone,256387,6974,1
MoaD,256481,6982,1
Heme cleavage,256499,6983,1
Regulatory subunit,256516,6984,1
transcription regulation,256532,6985,1
Heme cleavage,256568,6987,1
Ribosomal protein,256600,6989,1
phytotoxin,256631,6990,1
Cell Signaling,256646,6991,1
cell wall component,256662,6992,1
Cell Signaling,256683,6993,1
Translation Initiation,256699,6995,1
Cell Signaling,256719,6996,1
Cell Signaling,256754,6998,1
mRNA export factor,257237,7023,1
chemotaxis,257265,7024,1
inhibit CC chemokine,257266,7024,2
modular domain,257437,7035,1
modular domain,257455,7036,1
peptidyl-tRNA hydrolase,257576,7055,1
RNA polymerase,257600,7056,1
splicing protein,257924,7070,1
U6 RNA,257924,7070,1
DNA-binding,258008,7074,1
dimerization,258153,7082,1
DNA binding,258153,7082,1
starch-binding,258178,7083,1
delivery of fMet-tRNA to the ribosome,258281,7088,1
Protease- Degrades Elastin and alpha1-antitrypsin,258302,7089,1
Antimicrobial,258347,7092,1
Catalyzes the hydrolysis of acylphosphates,258379,7094,1
Genome replication specificity determinant,258668,7112,1
Initiation of nanovirus replication (nuclease),258668,7112,1
Termination of replication (ligase),258668,7112,1
Structural protein,258687,7113,1
translation initiation factor,258718,7115,1
protein interaction,258765,7118,1
E3 ligase,258875,7124,1
endoribonuclease activity,258911,7126,1
RNA binding,258911,7126,1
ribonuclease inhibitor activity,258912,7126,2
Structural protein,258942,7127,1
Structural protein,258960,7128,1
endoribonuclease activity,259116,7139,1
RNA binding,259116,7139,1
carrier of RBP,259209,7149,1
membrane-binding,259244,7151,1
Protein binding,259347,7158,1
Actin binding,259535,7172,1
E3 ubiquitin ligase,259560,7174,1
calcium-binding,259823,7190,1
Post translational Modification,259980,7202,1
histone binding,260184,7210,1
tumour supressor,260184,7210,1
binds to nAChR and block neurotransmission,260217,7211,1
neurotoxin,260217,7211,1
antigen mimic,260239,7212,1
antigen mimic,260261,7213,1
antigen mimic,260283,7214,1
antigen mimic,260305,7215,1
triose-phosphate isomerase activity,260326,7216,1
Initiation of nanovirus replication (nuclease),260346,7218,1
K63-linked polyubiquitin chain formation,260370,7219,1
inhibited mutase,260801,7234,1
inhibited mutase,260830,7235,1
beta-lactamase,260854,7236,1
beta-lactamase,260874,7237,1
beta-lactamase,260894,7238,1
beta-lactamase,260914,7239,1
transcription factor,261062,7246,1
component of U4 snRNP,261131,7249,1
IGF binding protein,261421,7262,1
ligand binding domain,261442,7263,1
unknown,261483,7266,1
Allergen,261658,7276,1
Unknown in mites,261658,7276,1
DNA binding,261733,7279,1
High Mobility Group Protein,261733,7279,1
transcription regulator,261884,7287,1
antibiotic,262036,7294,1
antifungal,262036,7294,1
CFC binds ALK4 receptor,262158,7299,1
Involved in tumor progression,262158,7299,1
signalling protein,262265,7305,1
signalling protein,262279,7306,1
cellular elimation signals for neutrophils,262417,7313,1
Dnase inhibitor,262488,7316,1
Trapped protein folding intermediate of Im7*,262506,7317,1
Trapped protein folding intermediate of Im7*,262524,7318,1
May be involved in a redox-related process,262622,7324,1
pheromone,262667,7326,1
kinase,262734,7340,1
cytosolic fatty acid binding protein,262867,7356,1
cytosolic fatty acid binding protein,262883,7357,1
inhibit protein kinase C activation pathways in T and probably also neuronal cell,262900,7358,1
involved in suppression of a T cell activation pathway,262900,7358,1
might have roles in myelin elaboration in the central nervous system during development and in remyelination attempts,262900,7358,1
participate in controlling Ca2+ influx in T cells,262900,7358,1
Copper pump,263127,7375,1
Menkes disease-associated protein,263127,7375,1
transcriptional repressor,263144,7376,1
transcriptional repressor,263165,7377,1
opertor/promoter,263166,7377,2
Yeast Ccc2 is a P-type ATPase responsible for transport of copper(I) from the cytosol to the trans-Golgi network,263441,7406,1
Secretin,263460,7407,1
Pilot protein,263461,7407,2
unknown,263567,7414,1
cleavage of the target,263587,7415,1
selective conduction of K+ ions across the cell membrane,263869,7428,1
Iron-sulfur cluster assembly scaffold protein,263921,7432,1
Llama heavy chain antibody selected against PABPN1,263963,7434,1