BMRB Entry 25459
Click here to enlarge.
PDB ID:
Entry in NMR Restraints Grid
Validation report in NRG-CING
Chem Shift validation: AVS_anomalous, AVS_full, LACS, SPARTA
BMRB Entry DOI: doi:10.13018/BMR25459
MolProbity Validation Chart
NMR-STAR file interactive viewer.
NMR-STAR v3 text file.
NMR-STAR v2.1 text file (deprecated)
XML gzip file.
RDF gzip file.
All files associated with the entry
Title: Solution structure of Fungus protein Q8J180_MAGGR PubMed: 26506000
Deposition date: 2015-01-30 Original release date: 2015-10-12
Authors: de Guillen, Karine
Citation: de Guillen, Karine; Ortiz-Vallejo, Diana; Gracy, Jerome; Fournier, Elisabeth; Kroj, Thomas; Padilla, Andre. "Structure analysis uncovers a highly diverse but structurally conserved effector family in phytopathogenic fungi" PLOS PATHOG. 11, e1005228-e1005228 (2015).
Assembly members:
AVR1-CO39, polymer, 98 residues, 9136.090 Da.
Natural source: Common Name: Rice blast fungus Taxonomy ID: 148305 Superkingdom: Eukaryota Kingdom: Fungi Genus/species: Magnaporthe grisea
Experimental source: Production method: recombinant technology Host organism: Escherichia coli
Entity Sequences (FASTA):
AVR1-CO39: APQDNTSMGSSHHHHHHSSG
RENLYFQGHMAWKDCIIQRY
KDGDVNNIYTANRNEEITIE
EYKVFVNEACHPYPVILPDR
SVLSGDFTSAYADDDESC
- assigned_chemical_shifts
Data type | Count |
13C chemical shifts | 238 |
15N chemical shifts | 86 |
1H chemical shifts | 493 |
Additional metadata:
Assembly:
Entity Assembly ID | Entity Name | Entity ID |
---|---|---|
1 | AVR1-CO39 | 1 |
Entities:
Entity 1, AVR1-CO39 98 residues - 9136.090 Da.
the sequence "APQDNTSMGSSHHHHHHSSGRENLYFQGHM" is the His-TAG and the TEV cleavage site
1 | ALA | PRO | GLN | ASP | ASN | THR | SER | MET | GLY | SER | ||||
2 | SER | HIS | HIS | HIS | HIS | HIS | HIS | SER | SER | GLY | ||||
3 | ARG | GLU | ASN | LEU | TYR | PHE | GLN | GLY | HIS | MET | ||||
4 | ALA | TRP | LYS | ASP | CYS | ILE | ILE | GLN | ARG | TYR | ||||
5 | LYS | ASP | GLY | ASP | VAL | ASN | ASN | ILE | TYR | THR | ||||
6 | ALA | ASN | ARG | ASN | GLU | GLU | ILE | THR | ILE | GLU | ||||
7 | GLU | TYR | LYS | VAL | PHE | VAL | ASN | GLU | ALA | CYS | ||||
8 | HIS | PRO | TYR | PRO | VAL | ILE | LEU | PRO | ASP | ARG | ||||
9 | SER | VAL | LEU | SER | GLY | ASP | PHE | THR | SER | ALA | ||||
10 | TYR | ALA | ASP | ASP | ASP | GLU | SER | CYS |
Samples:
13C-15N: AVR1-CO39, [U-13C; U-15N], 1 ± 0.1 mM; D2O 10%; H2O 90%; sodium phosphate 20 mM; NaCl 150 mM; DTT 1 mM
15N: AVR1-CO39, [U-15N], 1 ± 0.1 mM; D2O 10%; H2O 90%; sodium phosphate 20 mM; NaCl 150 mM; DTT 1 mM
D2O: AVR1-CO39 1 ± 0.1 mM; D2O 100%; sodium phosphate 20 mM; NaCl 150 mM; DTT 1 mM
H2O: AVR1-CO39 1 ± 0.1 mM; D2O 10%; H2O 90%; sodium phosphate 20 mM; NaCl 150 mM; DTT 1 mM
sample_conditions_1: ionic strength: 0.15 M; pH: 6.8; pressure: 1 atm; temperature: 305 K
Experiments:
Name | Sample | Sample state | Sample conditions |
---|---|---|---|
2D 1H-15N HSQC | 15N | isotropic | sample_conditions_1 |
2D 1H-15N HSQC | 13C-15N | isotropic | sample_conditions_1 |
2D 1H-13C HSQC | 13C-15N | isotropic | sample_conditions_1 |
3D HNCO | 13C-15N | isotropic | sample_conditions_1 |
3D HNCA | 13C-15N | isotropic | sample_conditions_1 |
3D HN(COCA)CB | 13C-15N | isotropic | sample_conditions_1 |
3D 1H-15N NOESY | 13C-15N | isotropic | sample_conditions_1 |
3D 1H-15N TOCSY | 13C-15N | isotropic | sample_conditions_1 |
2D 1H-1H NOESY | H2O | isotropic | sample_conditions_1 |
2D 1H-1H NOESY | D2O | isotropic | sample_conditions_1 |
2D 1H-1H TOCSY | H2O | isotropic | sample_conditions_1 |
2D DQF-COSY | H2O | isotropic | sample_conditions_1 |
3D HNCACB | 13C-15N | isotropic | sample_conditions_1 |
3D HN(CO)CA | 13C-15N | isotropic | sample_conditions_1 |
Software:
TOPSPIN v2.1, Bruker Biospin - collection, processing
CCPN, CCPN - data analysis, peak picking
CYANA v2.1, Guntert, Mumenthaler and Wuthrich - structure solution
TALOS+ v1.2, Cornilescu, Delaglio and Bax - data analysis
CNS v1.2, Brunger, Adams, Clore, Gros, Nilges and Read - refinement
NMR spectrometers:
- Bruker Avance 700 MHz
- Bruker Avance 500 MHz
Download simulated HSQC data in one of the following formats:
CSV: Backbone
or all simulated shifts
SPARKY: Backbone
or all simulated shifts