BMRB Entry 25167
Chem Shift validation: AVS_full, LACS
BMRB Entry DOI: doi:10.13018/BMR25167
NMR-STAR file interactive viewer.
NMR-STAR v3 text file.
NMR-STAR v2.1 text file (deprecated)
XML gzip file.
RDF gzip file.
All files associated with the entry
Title: Backbone 1H, 13C, and 15N Chemical Shift Assignments for CS domain of human Shq1 PubMed: 25553844
Deposition date: 2014-08-20 Original release date: 2015-10-23
Authors: Singh, Mahavir; Wang, Zhonghua; Cascio, Duilio; Feigon, Juli
Citation: Singh, Mahavir; Wang, Zhonghua; Cascio, Duilio; Feigon, Juli. "Structure and interactions of the CS domain of human H/ACA RNP assembly protein Shq1" J. Mol. Biol. 427, 807-823 (2015).
Assembly members:
Human_Shq1_CS_domain, polymer, 133 residues, Formula weight is not available
Natural source: Common Name: Human Taxonomy ID: 9606 Superkingdom: Eukaryota Kingdom: Metazoa Genus/species: Homo sapiens
Experimental source: Production method: recombinant technology Host organism: Escherichia coli
Entity Sequences (FASTA):
Human_Shq1_CS_domain: GSTAIGMKETAAAKFERQHM
DSPDLGTGGGSGDDDDKMLT
PAFDLSQDPDFLTIAIRVPY
ARVSEFDVYFEGSDFKFYAK
PYFLRLTLPGRIVENGSEQG
SYDADKGIFTIRLPKETPGQ
HFEGLNMLTALLA
- assigned_chemical_shifts
| Data type | Count |
| 13C chemical shifts | 261 |
| 15N chemical shifts | 86 |
| 1H chemical shifts | 86 |
Additional metadata:
Assembly:
| Entity Assembly ID | Entity Name | Entity ID |
|---|---|---|
| 1 | Human Shq1 CS domain | 1 |
Entities:
Entity 1, Human Shq1 CS domain 133 residues - Formula weight is not available
GSTAIGMKETAAAKFERQHMDSPDLGTGGGSGDDDDK (residues -37 to -1) are from the vector after GST tag cleavage
| 1 | GLY | SER | THR | ALA | ILE | GLY | MET | LYS | GLU | THR | ||||
| 2 | ALA | ALA | ALA | LYS | PHE | GLU | ARG | GLN | HIS | MET | ||||
| 3 | ASP | SER | PRO | ASP | LEU | GLY | THR | GLY | GLY | GLY | ||||
| 4 | SER | GLY | ASP | ASP | ASP | ASP | LYS | MET | LEU | THR | ||||
| 5 | PRO | ALA | PHE | ASP | LEU | SER | GLN | ASP | PRO | ASP | ||||
| 6 | PHE | LEU | THR | ILE | ALA | ILE | ARG | VAL | PRO | TYR | ||||
| 7 | ALA | ARG | VAL | SER | GLU | PHE | ASP | VAL | TYR | PHE | ||||
| 8 | GLU | GLY | SER | ASP | PHE | LYS | PHE | TYR | ALA | LYS | ||||
| 9 | PRO | TYR | PHE | LEU | ARG | LEU | THR | LEU | PRO | GLY | ||||
| 10 | ARG | ILE | VAL | GLU | ASN | GLY | SER | GLU | GLN | GLY | ||||
| 11 | SER | TYR | ASP | ALA | ASP | LYS | GLY | ILE | PHE | THR | ||||
| 12 | ILE | ARG | LEU | PRO | LYS | GLU | THR | PRO | GLY | GLN | ||||
| 13 | HIS | PHE | GLU | GLY | LEU | ASN | MET | LEU | THR | ALA | ||||
| 14 | LEU | LEU | ALA |
Samples:
sample_1: Human Shq1 CS domain, [U-100% 15N], 0.2 – 1.0 mM; sodium phosphate 20 mM; sodium chloride 100 mM; DTT 2 mM; H2O 93%; D2O 7%; sodium azide 0.02%
sample_2: Human Shq1 CS domain, [U-100% 13C; U-100% 15N], 0.2 – 1.0 mM; sodium phosphate 20 mM; sodium chloride 100 mM; DTT 2 mM; H2O 93%; D2O 7%; sodium azide 0.02%
sample_conditions_1: pH: 7; pressure: 1 atm; temperature: 295 K
Experiments:
| Name | Sample | Sample state | Sample conditions |
|---|---|---|---|
| 2D 1H-15N HSQC | sample_1 | isotropic | sample_conditions_1 |
| 3D CBCA(CO)NH | sample_2 | isotropic | sample_conditions_1 |
| 3D HNCACB | sample_2 | isotropic | sample_conditions_1 |
| 3D HNCO | sample_2 | isotropic | sample_conditions_1 |
| 3D HCACO | sample_2 | isotropic | sample_conditions_1 |
Software:
TOPSPIN vBruker, Bruker Biospin - collection, data analysis, processing
SPARKY, Goddard - chemical shift assignment, data analysis, peak picking
NMR spectrometers:
- Bruker DRX 500 MHz
- Bruker DRX 600 MHz
- Bruker Avance 800 MHz
Related Database Links:
| BMRB | 19910 |
| PDB | |
| GB | AAH17204 AAH17274 AAH25270 AAH32671 AAH39830 |
| REF | NP_060600 XP_001082636 XP_001141951 XP_001493794 XP_003132372 |
| SP | Q6PI26 |
Download simulated HSQC data in one of the following formats:
CSV: Backbone
or all simulated shifts
SPARKY: Backbone
or all simulated shifts